SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP63751_P050
Price: $0.00
SKU
ARP63751_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-IL3RA (ARP63751_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: IQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRF
Concentration0.5 mg/ml
Blocking PeptideFor anti-IL3RA (ARP63751_P050) antibody is Catalog # AAP63751
Subunitalpha
Gene SymbolIL3RA
Gene Full NameInterleukin 3 receptor, alpha (low affinity)
Alias SymbolsIL3R, CD123, IL3RX, IL3RY, IL3RAY, hIL-3Ra
NCBI Gene Id3563
Protein NameInterleukin-3 receptor subunit alpha
Description of TargetThe protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y.
Uniprot IDP26951
Protein Accession #NP_002174
Nucleotide Accession #NM_002183
Protein Size (# AA)378
Molecular Weight41kDa
Protein InteractionsLNX1; FOXP1; SGK2; SAE1; NR0B2; GNA12; CDC25A; CDK1; PPP1CC; JAK1; IL3; CSF2RB; CSF2; CISH; JAK2;
  1. What is the species homology for "IL3RA Antibody - C-terminal region (ARP63751_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "IL3RA Antibody - C-terminal region (ARP63751_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "IL3RA Antibody - C-terminal region (ARP63751_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IL3RA Antibody - C-terminal region (ARP63751_P050)"?

    This target may also be called "IL3R, CD123, IL3RX, IL3RY, IL3RAY, hIL-3Ra" in publications.

  5. What is the shipping cost for "IL3RA Antibody - C-terminal region (ARP63751_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IL3RA Antibody - C-terminal region (ARP63751_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IL3RA Antibody - C-terminal region (ARP63751_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "41kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IL3RA Antibody - C-terminal region (ARP63751_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "IL3RA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IL3RA"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IL3RA"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IL3RA"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IL3RA"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IL3RA"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IL3RA Antibody - C-terminal region (ARP63751_P050)
Your Rating
We found other products you might like!