IL33 Recombinant Protein (Pig) (OPCA00133)

Catalog No: OPCA00133

Product Info

• Predicted Species Reactivity: Porcine|Sus scrofa
• Product Format: Liquid or Lyophilized powder
• Additional Information: Tag information : GST tag
  
• Reconstitution and Storage: -20°C or -80°C
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: EHSASLSTYNDQYITFAFEDGSYEIYVEDLRKDQEKDKVLLRYYDSQIPSSETDGGGDHRKLMVNLSPTKDKDFLLHANSKEHSVELQKCENPLPEQAFFVLHEQPSKCVSFECKSHPGVFLGVKNNQLALIKLGEHPEDSNRENTTFKLSNLM
• Protein Sequence: EHSASLSTYNDQYITFAFEDGSYEIYVEDLRKDQEKDKVLLRYYDSQIPSSETDGGGDHRKLMVNLSPTKDKDFLLHANSKEHSVELQKCENPLPEQAFFVLHEQPSKCVSFECKSHPGVFLGVKNNQLALIKLGEHPEDSNRENTTFKLSNLM
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 123-276 aa
• Tag: N-terminal GST-tagged

Target Info

• Reference: cDNA cloning and expression of porcine IL-33.Shimazu T., Tohno M., Kawai Y., Saito T., Kitazawa H.Submitted (FEB-2007)
• Gene Symbol: IL33
• Gene Full Name: interleukin 33
• Alias Symbols: IL-33;interleukin-33.
• NCBI Gene Id: 100518643
• Protein Name: Interleukin-33
• Description of Target: Recombinant Sus scrofa (Pig) Interleukin-33
• Uniprot ID: M5B263
• Protein Size (# AA): Recombinant
• Molecular Weight: 44.6 kDa