SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: OAAF08110-FITC
Size:100 ug
Price: $379.00
SKU
OAAF08110-FITC
Availability: Domestic: within 1 week delivery | International: 1 week
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

IL2RB Antibody : FITC (OAAF08110-FITC)

Datasheets/ManualsPrintable datasheet for OAAF08110-FITC
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB, ELISA
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe antiserum was produced against synthesized peptide derived from the N-terminal region of human IL2RB.
PurificationThe antibody was affinity-purified from rabbit antiserum by affinity-chromatography using peptide.
Peptide SequenceSynthetic peptide located within the following region: TSQFTCFYNSRANISCVWSQDGALQDTSCQVHAWPDRRRWNQTCELLPVS
Concentration1 mg/ml
SpecificityIL2RB Antibody detects endogenous levels of IL2RB protein.
Application InfoWB: 1:500~1:1000
ELISA: 1:10000
Gene SymbolIL2RB
Alias SymbolsCD122, IMD63, IL15RB, P70-75
NCBI Gene Id3560
Uniprot IDP14784
Molecular Weight61 kDa
  1. What is the species homology for "IL2RB Antibody : FITC (OAAF08110-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "IL2RB Antibody : FITC (OAAF08110-FITC)"?

    This item is available "Domestic: within 1 week delivery | International: 1 week".

  3. What buffer format is "IL2RB Antibody : FITC (OAAF08110-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IL2RB Antibody : FITC (OAAF08110-FITC)"?

    This target may also be called "CD122, IMD63, IL15RB, P70-75" in publications.

  5. What is the shipping cost for "IL2RB Antibody : FITC (OAAF08110-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IL2RB Antibody : FITC (OAAF08110-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IL2RB Antibody : FITC (OAAF08110-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "61 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IL2RB Antibody : FITC (OAAF08110-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "IL2RB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IL2RB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IL2RB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IL2RB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IL2RB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IL2RB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IL2RB Antibody : FITC (OAAF08110-FITC)
Your Rating
We found other products you might like!