SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP48069_P050-FITC
Size:100ul
Price: $434.00
SKU
ARP48069_P050-FITC
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

IL28RA Antibody - N-terminal region : FITC (ARP48069_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-IFNLR1 (ARP48069_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human IL28RA
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 77%; Rabbit: 86%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF
Concentration0.5 mg/ml
Blocking PeptideFor anti-IFNLR1 (ARP48069_P050-FITC) antibody is Catalog # AAP48069 (Previous Catalog # AAPS21112)
Subunitalpha
ReferenceChae,S.C., (2006) Exp. Mol. Med. 38 (3), 302-309
Publications

Mucha, J., Majchrzak, K., Taciak, B., Hellmén, E. & Król, M. MDSCs mediate angiogenesis and predispose canine mammary tumor cells for metastasis via IL-28/IL-28RA (IFN-λ) signaling. PLoS One 9, e103249 (2014). WB, Human, Guinea pig, Dog, Rat, Bovine, Horse, Rabbit, Mouse 25075523

Gene SymbolIFNLR1
Gene Full NameInterleukin 28 receptor, alpha (interferon, lambda receptor)
Alias SymbolsIFNLR, LICR2, IL28RA, CRF2/12, IL-28R1
NCBI Gene Id163702
Protein NameInterleukin-28 receptor subunit alpha
Description of TargetIL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB). The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29). The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.
Uniprot IDQ5VTX8
Protein Accession #NP_775087
Nucleotide Accession #NM_173064
Protein Size (# AA)491
Molecular Weight54kDa
Protein InteractionsIFNLR1; IFNL1; IFNL2; LSM8;
  1. What is the species homology for "IL28RA Antibody - N-terminal region : FITC (ARP48069_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "IL28RA Antibody - N-terminal region : FITC (ARP48069_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "IL28RA Antibody - N-terminal region : FITC (ARP48069_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IL28RA Antibody - N-terminal region : FITC (ARP48069_P050-FITC)"?

    This target may also be called "IFNLR, LICR2, IL28RA, CRF2/12, IL-28R1" in publications.

  5. What is the shipping cost for "IL28RA Antibody - N-terminal region : FITC (ARP48069_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IL28RA Antibody - N-terminal region : FITC (ARP48069_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IL28RA Antibody - N-terminal region : FITC (ARP48069_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IL28RA Antibody - N-terminal region : FITC (ARP48069_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "IFNLR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IFNLR1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IFNLR1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IFNLR1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IFNLR1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IFNLR1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IL28RA Antibody - N-terminal region : FITC (ARP48069_P050-FITC)
Your Rating
We found other products you might like!