SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP63701_P050
Price: $0.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

IL28B Antibody - C-terminal region (ARP63701_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-IFNL3 (ARP63701_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 93%; Horse: 86%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 85%; Rat: 77%
Peptide SequenceSynthetic peptide located within the following region: PRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDL
Concentration0.5 mg/ml
Blocking PeptideFor anti-IFNL3 (ARP63701_P050) antibody is Catalog # AAP63701
SpecificityThis antibody is pan-IL28 specific, as there is 100% homology to the human IL28A sequence, per //
Gene SymbolIFNL3
Gene Full NameInterleukin 28B (interferon, lambda 3)
Alias SymbolsIL28B, IL28C, IL-28B, IL-28C, IFN-lambda-3, IFN-lambda-4
NCBI Gene Id282617
Protein NameInterferon lambda-3
Description of TargetThis gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA).
Uniprot IDQ8IZI9
Protein Accession #NP_742151
Nucleotide Accession #NM_172139
Protein Size (# AA)196
Molecular Weight22kDa
Protein InteractionsIL10RB;
  1. What is the species homology for "IL28B Antibody - C-terminal region (ARP63701_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "IL28B Antibody - C-terminal region (ARP63701_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "IL28B Antibody - C-terminal region (ARP63701_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "IL28B Antibody - C-terminal region (ARP63701_P050)"?

    This target may also be called "IL28B, IL28C, IL-28B, IL-28C, IFN-lambda-3, IFN-lambda-4" in publications.

  5. What is the shipping cost for "IL28B Antibody - C-terminal region (ARP63701_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IL28B Antibody - C-terminal region (ARP63701_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IL28B Antibody - C-terminal region (ARP63701_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IL28B Antibody - C-terminal region (ARP63701_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "IFNL3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IFNL3"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IFNL3"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IFNL3"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IFNL3"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IFNL3"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IL28B Antibody - C-terminal region (ARP63701_P050)
Your Rating
We found other products you might like!