Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

IL27 Antibody - C-terminal region (ARP60748_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP60748_P050-FITC Conjugated

ARP60748_P050-HRP Conjugated

ARP60748_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Interleukin 27
NCBI Gene Id:
Protein Name:
Interleukin-27 subunit alpha
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
IL-27, IL-27A, IL27p28, IL30, MGC71873, p28, IL27A
Replacement Item:
This antibody may replace item sc-134367 from Santa Cruz Biotechnology.
Description of Target:
The protein encoded by this gene is one of the subunits of a heterodimeric cytokine complex. This protein is related to interleukin 12A (IL12A). It interacts with Epstein-Barr virus induced gene 3 (EBI3), a protein similar to interleukin 12B (IL12B), and forms a complex that has been shown to drive rapid expansion of naive but not memory CD4(+) T cells. The complex is also found to synergize strongly with interleukin 12 to trigger interferon gamma (IFNG) production of naive CD4(+) T cells. The biological effects of this cytokine are mediated by the class I cytokine receptor (WSX1/TCRR).
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IL27.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IL27.
The immunogen is a synthetic peptide directed towards the C terminal region of human IL27
Predicted Species Reactivity:
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-IL27 (ARP60748_P050)
Peptide Sequence:
Synthetic peptide located within the following region: AQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-IL27 (ARP60748_P050) antibody is Catalog # AAP60748 (Previous Catalog # AAPP46941)
Printable datasheet for anti-IL27 (ARP60748_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...