Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP60748_P050-FITC Conjugated

ARP60748_P050-HRP Conjugated

ARP60748_P050-Biotin Conjugated

IL27 Antibody - C-terminal region (ARP60748_P050)

Catalog#: ARP60748_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-134367 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human IL27
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-IL27 (ARP60748_P050)
Peptide Sequence Synthetic peptide located within the following region: AQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQ
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-IL27 (ARP60748_P050) antibody is Catalog # AAP60748 (Previous Catalog # AAPP46941)
Datasheets/Manuals Printable datasheet for anti-IL27 (ARP60748_P050) antibody
Subunit alpha
Gene Symbol IL27
Official Gene Full Name Interleukin 27
Alias Symbols IL-27, IL-27A, IL27p28, IL30, MGC71873, p28, IL27A
NCBI Gene Id 246778
Protein Name Interleukin-27 subunit alpha
Description of Target The protein encoded by this gene is one of the subunits of a heterodimeric cytokine complex. This protein is related to interleukin 12A (IL12A). It interacts with Epstein-Barr virus induced gene 3 (EBI3), a protein similar to interleukin 12B (IL12B), and forms a complex that has been shown to drive rapid expansion of naive but not memory CD4(+) T cells. The complex is also found to synergize strongly with interleukin 12 to trigger interferon gamma (IFNG) production of naive CD4(+) T cells. The biological effects of this cytokine are mediated by the class I cytokine receptor (WSX1/TCRR).
Swissprot Id Q8NEV9
Protein Accession # NP_663634
Nucleotide Accession # NM_145659
Protein Size (# AA) 243
Molecular Weight 27kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express IL27.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express IL27.
Protein Interactions IL27RA;
  1. What is the species homology for "IL27 Antibody - C-terminal region (ARP60748_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "IL27 Antibody - C-terminal region (ARP60748_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "IL27 Antibody - C-terminal region (ARP60748_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "IL27 Antibody - C-terminal region (ARP60748_P050)"?

    This target may also be called "IL-27, IL-27A, IL27p28, IL30, MGC71873, p28, IL27A" in publications.

  5. What is the shipping cost for "IL27 Antibody - C-terminal region (ARP60748_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IL27 Antibody - C-terminal region (ARP60748_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IL27 Antibody - C-terminal region (ARP60748_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "27kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IL27 Antibody - C-terminal region (ARP60748_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "IL27"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IL27"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IL27"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IL27"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IL27"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IL27"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IL27 Antibody - C-terminal region (ARP60748_P050)
Your Rating
We found other products you might like!