IL26 Antibody - N-terminal region : FITC (ARP64770_P050-FITC)

Catalog No: ARP64770_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Dog
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: LVTLSLAIAKHKQSSFTKSCYPRGTLSQAVDALYIKAAWLKATIPEDRIK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IL26 (ARP64770_P050-FITC) antibody is Catalog # AAP64770

Target Info

• Gene Symbol: IL26
• Gene Full Name: Interleukin 26
• Alias Symbols: AK155, IL-26
• NCBI Gene Id: 55801
• Protein Name: Interleukin-26
• Description of Target: This gene was identified by its overexpression specifically in herpesvirus samimiri-transformed T cells. The encoded protein is a member of the IL10 family of cytokines. It is a secreted protein and may function as a homodimer. This protein is thought to contribute to the transformed phenotype of T cells after infection by herpesvirus samimiri.
• Uniprot ID: Q9NPH9
• Protein Accession #: NP_060872
• Nucleotide Accession #: NM_018402
• Protein Size (# AA): 171
• Molecular Weight: 18kDa
• Protein Interactions: APP;