IL24 Antibody - C-terminal region (ARP53387_P050)

Catalog No: ARP53387_P050

WB Suggested Anti-IL24 Antibody
Titration: 1.0 ug/ml
Positive Control: HepG2 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of IL24
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 77%; Horse: 85%; Human: 100%; Mouse: 85%; Rat: 85%
• Peptide Sequence: Synthetic peptide located within the following region: STLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALT
• Concentration: 0.5 mg/ml
• Blocking Peptide: Available upon request

Target Info

• Gene Symbol: IL24
• Alias Symbols: C49A, FISP, MDA7, MOB5, ST16, IL10B
• NCBI Gene Id: 11009
• Protein Name: Interleukin-24
• Description of Target: This gene encodes a member of the IL10 family of cytokines. It was identified as a gene induced during terminal differentiation in melanoma cells. The protein encoded by this gene can induce apoptosis selectively in various cancer cells. Overexpression of this gene leads to elevated expression of several GADD family genes, which correlates with the induction of apoptosis. The phosphorylation of mitogen-activated protein kinase 14 (MAPK7/P38), and heat shock 27kDa protein 1 (HSPB2/HSP27) are found to be induced by this gene in melanoma cells, but not in normal immortal melanocytes. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
• Uniprot ID: Q53XZ7
• Protein Accession #: NP_001172085
• Nucleotide Accession #: NM_001185156
• Protein Size (# AA): 207
• Molecular Weight: 22kDa
• Protein Interactions: DCD; RARG; CCR5; CLU; UBC; IL20RA;