Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: OASA06288 (Formerly GWB-C50524)
Size:100UG
Price: $499.00
SKU
OASA06288
Availability: Domestic: within 1-2 weeks delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for IL21R Antibody - N-terminal region (OASA06288)
Product Info
Predicted Species ReactivityHuman
Product FormatLiquid. Phosphate buffered saline
ClonalityPolyclonal
IsotypePolyclonal IgG
HostGoat
ApplicationEnzyme-linked immunosorbent assay|Immunohistochemistry-Paraffin
Additional InformationHistology Positive Control Tissue: Human lung or tonsil.
::Preservative Stabilisers: 0.09% Sodium Azide (NaN3)
Antiserum Preparation: Antiserum to human IL-21R (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.
::Approx Protein Conc: IgG concentration 1.0mg/ml
Buffer Solutions: 10mM KHPO4, 140mM NaCl, pH7.2
Reconstitution and Storage-20°C
ImmunogenSynthetic peptide CILEMWNLHPSTLTLTWQDQYEELKDEATS corresponding to amino acids 35-65 within the N-terminal region of human IL-21R.
Predicted Homology Based on Immunogen SequenceHuman
Concentration1 mg/ml
SpecificityIL-21 RECEPTOR
Application InfoELISA : This product is suitable for use in indirect ELISA applications.
Application DataApplication #1: Staining of paraffin embedded human lung with Goat anti human interleukin-21 receptor (N-terminal) -
Gene SymbolIL21R
Alias SymbolsNILR, CD360, IMD56
NCBI Gene Id50615
Protein NameInterleukin-21 receptor
Description of TargetGOAT ANTI HUMAN INTERLEUKIN-21 RECEPTOR (N-TERMINAL)
Uniprot IDQ9HBE5
Protein Accession #NP_068570.1
Protein Size (# AA)538
  1. What is the species homology for "IL21R Antibody - N-terminal region (OASA06288)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "IL21R Antibody - N-terminal region (OASA06288)"?

    This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".

  3. What buffer format is "IL21R Antibody - N-terminal region (OASA06288)" provided in?

    This item is provided in "Liquid. Phosphate buffered saline".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IL21R Antibody - N-terminal region (OASA06288)"?

    This target may also be called "NILR, CD360, IMD56" in publications.

  5. What is the shipping cost for "IL21R Antibody - N-terminal region (OASA06288)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IL21R Antibody - N-terminal region (OASA06288)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IL21R Antibody - N-terminal region (OASA06288)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IL21R Antibody - N-terminal region (OASA06288)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "IL21R"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IL21R"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IL21R"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IL21R"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IL21R"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IL21R"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IL21R Antibody - N-terminal region (OASA06288)
Your Rating
We found other products you might like!