- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-IL21 (OAAN02188) Please click here to view the MSDS. |
---|
Predicted Species Reactivity | Mouse, Rat |
---|---|
Product Format | Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3) |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Conjugation | Unconjugated |
Application | WB, IHC |
:: | Positive Samples: Mouse testis, mouse liver, mouse skin, mouse thymus Cellular Location: Secreted. |
Reconstitution and Storage | Store at -20C. Avoid repeated freeze/thaw cycles. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-162 of human IL21 (NP_068575.1). |
Purification | Affinity purification |
Peptide Sequence | HKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
Application Info | WB: 1:500~2000 IHC: 1:50~200 |
Gene Symbol | IL21 |
---|---|
Gene Full Name | interleukin 21 |
Alias Symbols | Za11, IL-21, CVID11 |
NCBI Gene Id | 59067 |
Protein Name | Interleukin-21 |
Description of Target | This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. |
Uniprot ID | Q9HBE4 |
Protein Accession # | NP_001193935.1 |
Nucleotide Accession # | NM_001207006.2 |
Molecular Weight | 18 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "IL21 Antibody (OAAN02188)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Mouse, Rat".
-
How long will it take to receive "IL21 Antibody (OAAN02188)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "IL21 Antibody (OAAN02188)" provided in?
This item is provided in "Liquid PBS with 0.02% sodium azide, 50% glycerol (pH 7.3)".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "IL21 Antibody (OAAN02188)"?
This target may also be called "Za11, IL-21, CVID11" in publications.
-
What is the shipping cost for "IL21 Antibody (OAAN02188)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "IL21 Antibody (OAAN02188)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "IL21 Antibody (OAAN02188)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "18 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "IL21 Antibody (OAAN02188)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "IL21"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "IL21"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "IL21"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "IL21"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "IL21"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "IL21"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.