IL1RAP Antibody - C-terminal region : FITC (ARP76299_P050-FITC)

Catalog No: ARP76299_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen for Anti-IL1RAP antibody is: synthetic peptide directed towards the C-terminal region of Human IL1AP
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: KELKRAKTVLTVIKWKGEKSKYPQGRFWKQLQVAMPVKKSPRRSSSDEQG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For Anti-IL1RAP antibody is Catalog # AAP76299
• Reference: N/A

Target Info

• Gene Symbol: IL1RAP
• Gene Full Name: interleukin 1 receptor accessory protein
• Alias Symbols: IL1R3, C3orf13, IL-1RAcP
• NCBI Gene Id: 3556
• Description of Target: Interleukin 1 induces synthesis of acute phase and proinflammatory proteins during infection, tissue damage, or stress, by forming a complex at the cell membrane with an interleukin 1 receptor and an accessory protein. This gene encodes the interleukin 1 receptor accessory protein. The protein is a necessary part of the interleukin 1 receptor complex which initiates signalling events that result in the activation of interleukin 1-responsive genes. Alternative splicing of this gene results in two transcript variants encoding two different isoforms, one membrane-bound and one soluble. The ratio of soluble to membrane-bound forms increases during acute-phase induction or stress.
• Uniprot ID: Q9NPH3
• Protein Size (# AA): 570
• Molecular Weight: 62 kDa