IL1RAP Antibody - C-terminal region (ARP90469_P050)

Catalog No: ARP90469_P050

Host: Rabbit
Target Name: IL1RAP
Sample Tissue: Mouse Liver lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Mouse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of mouse IL1RAP
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: RAKTVLTVIKWKGEKSKYPQGRFWKQLQVAMPVKKSPRWSSNDKQGLSYS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IL1RAP (ARP90469_P050) antibody is Catalog # AAP90469

Target Info

• Gene Symbol: IL1RAP
• Gene Full Name: interleukin 1 receptor accessory protein
• Alias Symbols: IL-, AI255955, AV239853, IL-1RAcP, 6430709H04Rik
• NCBI Gene Id: 16180
• Protein Name: interleukin-1 receptor accessory protein
• Description of Target: Coreceptor for IL1RL2 in the IL-36 signaling system. Coreceptor with IL1R1 in the IL-1 signaling system. Associates with IL1R1 bound to IL1B to form the high affinity interleukin-1 receptor complex which mediates interleukin-1-dependent activation of NF-kappa-B and other pathways. Signaling involves the recruitment of adapter molecules such as TOLLIP, MYD88, and IRAK1 or IRAK2 via the respective TIR domains of the receptor/coreceptor subunits. Recruits TOLLIP to the signaling complex. Does not bind to interleukin-1 alone; binding of IL1RN to IL1R1, prevents its association with IL1R1 to form a signaling complex. The cellular response is modulated through a non-signaling association with the membrane IL1R2 decoy receptor. Secreted forms (isoforms 2 and 3) associate with secreted ligand-bound IL1R2 and increase the affinity of secreted IL1R2 for IL1B; this complex formation may be the dominant mechanism for neutralization of IL1B by secreted/soluble receptors. Coreceptor for IL1RL1 in the IL-33 signaling system. Can bidirectionally induce pre- and postsynaptic differentiation of neurons by trans-synaptically binding to PTPRD. May play a role in IL1B-mediated costimulation of IFNG production from T-helper 1 (Th1) cells (By similarity).
• Uniprot ID: Q61730
• Protein Accession #: NP_001152790.1
• Nucleotide Accession #: NM_001159318.1
• Protein Size (# AA): 570
• Molecular Weight: 62 kDa