IL1B Recombinant Protein (Human) (OPCA04187)

Catalog No: OPCA04187

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Protein Description: Full Length
• Reconstitution and Storage: -20°C or -80°C
• Purification: Affinity purified using IMAC.
• Concentration: Varies by lot. See vial for exact concentration.
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
• Protein Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 117-269 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Cloning, sequence and expression of two distinct human interleukin-1 complementary DNAs.March C.J., Mosley B., Larsen A., Cerretti D.P., Braedt G., Price V., Gillis S., Henney C.S., Kronheim S.R., Grabstein K., Conlon P.J., Hopp T.P., Cosman D.Nature 315:641-647(1985)

Target Info

• Gene Symbol: IL1B
• Gene Full Name: interleukin 1 beta
• Alias Symbols: catabolin;IL-1;IL-1 beta;IL1beta;IL1-BETA;IL1F2;interleukin 1beta;interleukin-1 beta;preinterleukin 1 beta;pro-interleukin-1-beta.
• NCBI Gene Id: 3553
• Protein Name: Interleukin-1 beta
• Description of Target: Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production. Promotes Th17 differentiation of T-cells. Synergizes with IL12/interleukin-12 to induce IFNG synthesis from T-helper 1 (Th1) cells (PubMed:10653850).
• Uniprot ID: P01584
• Protein Accession #: NP_000567
• Nucleotide Accession #: NM_000576
• Protein Size (# AA): Recombinant
• Molecular Weight: 33.4 kDa