IL1B Antibody - N-terminal region (ARP54324_P050)

Catalog No: ARP54324_P050

WB Suggested Anti-IL1B Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta

Host: Rabbit
Target Name: IL1B
Sample Tissue: Human Stomach Tumor
Antibody Dilution: 1ug/ml

Human Macrophage

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IL1B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: DLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IL1B (ARP54324_P050) antibody is Catalog # AAP54324 (Previous Catalog # AAPP31072)
• Reference: Piccini,A., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (23), 8067-8072

Target Info

• Gene Symbol: IL1B
• Gene Full Name: Interleukin 1, beta
• Alias Symbols: IL-1, IL1F2, IL1beta, IL1-BETA
• NCBI Gene Id: 3553
• Protein Name: Interleukin-1 beta
• Description of Target: IL1B is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. The gene encoding IL1B and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P01584
• Protein Accession #: NP_000567
• Nucleotide Accession #: NM_000576
• Protein Size (# AA): 153
• Molecular Weight: 17kDa
• Protein Interactions: PTPN1; LYN; FYN; CMA1; CASP1; APP; SP1; EGR1; ELAVL1; CASP4; IL1RAP; PRTN3; IL1R2; IL1R1; IL1B; MMP2; ADRB2; A2M; UBE2N; ZNF675; MAPK8IP2;