Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP54323_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54323_P050-FITC Conjugated

ARP54323_P050-HRP Conjugated

ARP54323_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Dog, Horse, Human, Mouse, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-111184 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human IL1B
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 92%; Horse: 86%; Human: 100%; Mouse: 75%; Rabbit: 92%
Complete computational species homology data Anti-IL1B (ARP54323_P050)
Peptide Sequence Synthetic peptide located within the following region: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-IL1B (ARP54323_P050) antibody is Catalog # AAP54323 (Previous Catalog # AAPP43207)
Datasheets/Manuals Printable datasheet for anti-IL1B (ARP54323_P050) antibody
Publications

Lee, FY; Lu, HI; Chai, HT; Sheu, JJ; Chen, YL; Huang, TH; Kao, GS; Chen, SY; Chung, SY; Sung, PH; Chang, HW; Lee, MS; Yip, HK; Circulating microparticles enhanced rat vascular wall remodeling following endothelial denudation. 8, 4511-4522 (2016). IHC, WB, Dog, Horse, Human, Mouse, Rabbit 27904658

Wang, F. et al. Shigella flexneri T3SS effector IpaH4.5 modulates the host inflammatory response via interaction with NF-κB p65 protein. Cell. Microbiol. 15, 474-85 (2013). IHC, WB, Dog, Horse, Human, Mouse, Rabbit 23083102

Gene Symbol IL1B
Official Gene Full Name Interleukin 1, beta
Alias Symbols IL-1, IL1-BETA, IL1F2
NCBI Gene Id 3553
Protein Name Interleukin-1 beta
Description of Target IL1B is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. The gene encoding IL1B and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.
Swissprot Id P01584
Protein Accession # NP_000567
Nucleotide Accession # NM_000576
Protein Size (# AA) 269
Molecular Weight 17
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express IL1B.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express IL1B.
Protein Interactions PTPN1; LYN; FYN; CMA1; CASP1; APP; SP1; EGR1; ELAVL1; CASP4; IL1RAP; PRTN3; IL1R2; IL1R1; IL1B; MMP2; ADRB2; A2M; UBE2N; ZNF675; MAPK8IP2;
Write Your Own Review
You're reviewing:IL1B Antibody - N-terminal region (ARP54323_P050)
Your Rating