Search Antibody, Protein, and ELISA Kit Solutions

IL1B Antibody - N-terminal region (ARP54323_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP54323_P050-FITC Conjugated

ARP54323_P050-HRP Conjugated

ARP54323_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Dog, Horse, Human, Mouse, Rabbit
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-111184 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human IL1B
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Dog: 92%; Horse: 86%; Human: 100%; Mouse: 75%; Rabbit: 92%
Complete computational species homology data:
Anti-IL1B (ARP54323_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-IL1B (ARP54323_P050) antibody is Catalog # AAP54323 (Previous Catalog # AAPP43207)
Printable datasheet for anti-IL1B (ARP54323_P050) antibody

Lee, FY; Lu, HI; Chai, HT; Sheu, JJ; Chen, YL; Huang, TH; Kao, GS; Chen, SY; Chung, SY; Sung, PH; Chang, HW; Lee, MS; Yip, HK; Circulating microparticles enhanced rat vascular wall remodeling following endothelial denudation. 8, 4511-4522 (2016). IHC, WB, Dog, Horse, Human, Mouse, Rabbit 27904658

Wang, F. et al. Shigella flexneri T3SS effector IpaH4.5 modulates the host inflammatory response via interaction with NF-κB p65 protein. Cell. Microbiol. 15, 474-85 (2013). IHC, WB, Dog, Horse, Human, Mouse, Rabbit 23083102

Gene Symbol:
Official Gene Full Name:
Interleukin 1, beta
Alias Symbols:
NCBI Gene Id:
Protein Name:
Interleukin-1 beta
Description of Target:
IL1B is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. The gene encoding IL1B and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IL1B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IL1B.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...