Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
ARP54323_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP54323_P050-FITC Conjugated

ARP54323_P050-HRP Conjugated

ARP54323_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Dog, Horse, Human, Mouse, Rabbit
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-111184 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human IL1B
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Dog: 92%; Horse: 86%; Human: 100%; Mouse: 75%; Rabbit: 92%
Complete computational species homology data Anti-IL1B (ARP54323_P050)
Peptide Sequence Synthetic peptide located within the following region: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-IL1B (ARP54323_P050) antibody is Catalog # AAP54323 (Previous Catalog # AAPP43207)
Datasheets/Manuals Printable datasheet for anti-IL1B (ARP54323_P050) antibody
Publications

Lee, FY; Lu, HI; Chai, HT; Sheu, JJ; Chen, YL; Huang, TH; Kao, GS; Chen, SY; Chung, SY; Sung, PH; Chang, HW; Lee, MS; Yip, HK; Circulating microparticles enhanced rat vascular wall remodeling following endothelial denudation. 8, 4511-4522 (2016). IHC, WB, Dog, Horse, Human, Mouse, Rabbit 27904658

Wang, F. et al. Shigella flexneri T3SS effector IpaH4.5 modulates the host inflammatory response via interaction with NF-κB p65 protein. Cell. Microbiol. 15, 474-85 (2013). IHC, WB, Dog, Horse, Human, Mouse, Rabbit 23083102

Gene Symbol IL1B
Official Gene Full Name Interleukin 1, beta
Alias Symbols IL-1, IL1-BETA, IL1F2
NCBI Gene Id 3553
Protein Name Interleukin-1 beta
Description of Target IL1B is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. The gene encoding IL1B and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.
Swissprot Id P01584
Protein Accession # NP_000567
Nucleotide Accession # NM_000576
Protein Size (# AA) 269
Molecular Weight 17
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express IL1B.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express IL1B.
Protein Interactions PTPN1; LYN; FYN; CMA1; CASP1; APP; SP1; EGR1; ELAVL1; CASP4; IL1RAP; PRTN3; IL1R2; IL1R1; IL1B; MMP2; ADRB2; A2M; UBE2N; ZNF675; MAPK8IP2;
  1. What is the species homology for "IL1B Antibody - N-terminal region (ARP54323_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Dog, Horse, Human, Mouse, Rabbit".

  2. How long will it take to receive "IL1B Antibody - N-terminal region (ARP54323_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "IL1B Antibody - N-terminal region (ARP54323_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IL1B Antibody - N-terminal region (ARP54323_P050)"?

    This target may also be called "IL-1, IL1-BETA, IL1F2" in publications.

  5. What is the shipping cost for "IL1B Antibody - N-terminal region (ARP54323_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IL1B Antibody - N-terminal region (ARP54323_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IL1B Antibody - N-terminal region (ARP54323_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "17".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IL1B Antibody - N-terminal region (ARP54323_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "IL1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IL1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IL1B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IL1B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IL1B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IL1B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IL1B Antibody - N-terminal region (ARP54323_P050)
Your Rating
We found other products you might like!