- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
IL1A Antibody (OAAN00770)
Datasheets/Manuals | Printable datasheet for anti-IL1A (OAAN00770) |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid. PBS with 0.02% sodium azide, 50% glycerol, pH 7.3 |
Clonality | Polyclonal |
Isotype | IgG |
Host | Rabbit |
Conjugation | Unconjugated |
Application | WB |
:: | Positive Samples: NCl-H460, SKOV3, HeLa Cellular Location: Secreted |
Reconstitution and Storage | Store at -20C. Avoid repeated freeze/thaw cycles. |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 112-271 of human IL1A (NP_000566.3). |
Purification | Affinity purified against immunogen |
Peptide Sequence | RSAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA |
Application Info | WB: 1:500~2000 |
Publications | MicroRNA-regulated pathways of flow-stimulated angiogenesis and vascular remodeling in vivo. J Transl Med. 17, 22 (2019). 30635008 |
Description |
Gene Symbol | IL1A |
---|---|
Gene Full Name | interleukin 1 alpha |
Alias Symbols | IL1, IL-1A, IL1F1, IL1-ALPHA, IL-1 alpha |
NCBI Gene Id | 3552 |
Protein Name | Interleukin-1 alpha |
Description of Target | The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. It has been suggested that the polymorphism of these genes is associated with rheumatoid arthritis and Alzheimer's disease. |
Uniprot ID | P01583 |
Protein Accession # | NP_000566.3 |
Nucleotide Accession # | NM_000575.4 |
Molecular Weight | 31 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "IL1A Antibody (OAAN00770)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human".
-
How long will it take to receive "IL1A Antibody (OAAN00770)"?
This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".
-
What buffer format is "IL1A Antibody (OAAN00770)" provided in?
This item is provided in "Liquid. PBS with 0.02% sodium azide, 50% glycerol, pH 7.3".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "IL1A Antibody (OAAN00770)"?
This target may also be called "IL1, IL-1A, IL1F1, IL1-ALPHA, IL-1 alpha" in publications.
-
What is the shipping cost for "IL1A Antibody (OAAN00770)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "IL1A Antibody (OAAN00770)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "IL1A Antibody (OAAN00770)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "31 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "IL1A Antibody (OAAN00770)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "IL1A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "IL1A"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "IL1A"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "IL1A"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "IL1A"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "IL1A"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.