Search Antibody, Protein, and ELISA Kit Solutions

IL12B Antibody - middle region (ARP80710_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
IL12B
Official Gene Full Name:
interleukin 12B
NCBI Gene Id:
3593
Protein Name:
interleukin-12 subunit beta
Swissprot Id:
P29460
Protein Accession #:
NP_002178.2
Nucleotide Accession #:
NM_002187.2
Alias Symbols:
CLMF, NKSF, CLMF2, IMD28, IMD29, NKSF2, IL-12B
Description of Target:
This gene encodes a subunit of interleukin 12, a cytokine that acts on T and natural killer cells, and has a broad array of biological activities. Interleukin 12 is a disulfide-linked heterodimer composed of the 40 kD cytokine receptor like subunit encoded by this gene, and a 35 kD subunit encoded by IL12A. This cytokine is expressed by activated macrophages that serve as an essential inducer of Th1 cells development. This cytokine has been found to be important for sustaining a sufficient number of memory/effector Th1 cells to mediate long-term protection to an intracellular pathogen. Overexpression of this gene was observed in the central nervous system of patients with multiple sclerosis (MS), suggesting a role of this cytokine in the pathogenesis of the disease. The promoter polymorphism of this gene has been reported to be associated with the severity of atopic and non-atopic asthma in children.
Protein Size (# AA):
328
Molecular Weight:
36 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IL12B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IL12B.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human IL12B
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: IKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-IL12B (ARP80710_P050) antibody is Catalog # AAP80710
Datasheets/Manuals:
Printable datasheet for anti-IL12B (ARP80710_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...