IL-8 Recombinant Protein (Dog) (OPCA03639)

Catalog No: OPCA03639

IL-8 Recombinant Protein (Dog) (OPCA03639) in SDS-PAGE showing the molecular weight of approximately 13.2 kDa.

Product Info

• Predicted Species Reactivity: Canis lupus|Dog
• Product Format: Liquid or Lyophilized powder
• Host: Dog
• Additional Information: Relevance: IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
• Protein Sequence: AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Mammalian Cells
• Protein Range: 23-101 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Borrelia burgdorferi migrates into joint capsules and causes an up-regulation of interleukin-8 in synovial membranes of dogs experimentally infected with ticks.Straubinger R.K., Straubinger A.F., Harter L., Jacobson R.H., Chang Y.-F., Summers B.A., Erb H.N., Appel M.J.Infect. Immun. 65:1273-1285(1997)
• Gene Symbol: CXCL8
• Gene Full Name: C-X-C motif chemokine ligand 8
• Alias Symbols: chemokine (C-X-C motif) ligand 8;C-X-C motif chemokine 8;IL8;IL-8;interleukin-8.
• NCBI Gene Id: 403850
• Protein Name: Interleukin-8
• Description of Target: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
• Uniprot ID: P41324
• Protein Accession #: NP_001003200.1
  
• Nucleotide Accession #: NM_001003200.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 13.1 kDa