- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
| Datasheets/Manuals | Printable datasheet for IL-4R/CD124 Antibody (Phospho-Tyr497) (OAAF07610) |
|---|
| Predicted Species Reactivity | Human|Mouse |
|---|---|
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | Enzyme-linked immunosorbent assay|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Paraffin|Western blot |
| Additional Information | Modification Sites: Human:Y497 Mouse:Y500 |
| Reconstitution and Storage | -20°C |
| Immunogen | The antiserum was produced against synthesized peptide derived from human IL-4R/CD124 around the phosphorylation site of Tyr497. |
| Purification | The antibody was purified from rabbit antiserum by affinity-chromatography using phospho peptide. The antibody against non-phospho peptide was removed by chromatography using corresponding non-phospho peptide. |
| Peptide Sequence | Synthetic peptide located within the following region: QPLHLEPSPPASPTQSPDNLTCTETPLVIAGNPAYRSFSNSLSQSPCPRE |
| Concentration | 1mg/ml |
| Specificity | IL-4R/CD124 (Phospho-Tyr497) Antibody detects endogenous levels of IL-4R/CD124 only when phosphorylated at Tyr497. |
| Formulation | Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. |
| Application Info | WB: 1:500~1:1000 IF: 1:100~1:500 ELISA: 1:1000 |
| Gene Symbol | IL4R |
|---|---|
| Gene Full Name | interleukin 4 receptor |
| Alias Symbols | CD124;IL-4 receptor subunit alpha;IL4R nirs variant 1;IL4RA;IL-4RA;interleukin 13 receptor;interleukin-4 receptor alpha chain;interleukin-4 receptor subunit alpha. |
| NCBI Gene Id | 3566 |
| Protein Name | Interleukin-4 receptor subunit alpha |
| Description of Target | Receptor for both interleukin 4 and interleukin 13. Couples to the JAK1/2/3-STAT6 pathway. The IL4 response is involved in promoting Th2 differentiation. The IL4/IL13 responses are involved in regulating IgE production and, chemokine and mucus production at sites of allergic inflammation. In certain cell types, can signal through activation of insulin receptor substrates, IRS1/IRS2. |
| Uniprot ID | P24394 |
| Molecular Weight | 89 kDa |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "IL-4R/CD124 Antibody (Phospho-Tyr497) (OAAF07610)"?
The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human|Mouse".
-
How long will it take to receive "IL-4R/CD124 Antibody (Phospho-Tyr497) (OAAF07610)"?
This item is available "Domestic: within 1-2 week delivery | International: 1-2 weeks".
-
What buffer format is "IL-4R/CD124 Antibody (Phospho-Tyr497) (OAAF07610)" provided in?
This item is provided in "".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "IL-4R/CD124 Antibody (Phospho-Tyr497) (OAAF07610)"?
This target may also be called "CD124;IL-4 receptor subunit alpha;IL4R nirs variant 1;IL4RA;IL-4RA;interleukin 13 receptor;interleukin-4 receptor alpha chain;interleukin-4 receptor subunit alpha." in publications.
-
What is the shipping cost for "IL-4R/CD124 Antibody (Phospho-Tyr497) (OAAF07610)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "IL-4R/CD124 Antibody (Phospho-Tyr497) (OAAF07610)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "IL-4R/CD124 Antibody (Phospho-Tyr497) (OAAF07610)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "89 kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "IL-4R/CD124 Antibody (Phospho-Tyr497) (OAAF07610)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "IL4R"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "IL4R"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "IL4R"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "IL4R"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "IL4R"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "IL4R"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.
