SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP45230_T100-Biotin
Size:100ul
Price: $384.00
SKU
ARP45230_T100-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

IHH Antibody - N-terminal region : Biotin (ARP45230_T100-Biotin)

Datasheets/ManualsPrintable datasheet for anti-IHH (ARP45230_T100-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human IHH
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR
Concentration0.5 mg/ml
Blocking PeptideFor anti-IHH (ARP45230_T100-Biotin) antibody is Catalog # AAP45230 (Previous Catalog # AAPP26226)
ReferenceKobune,M., (2004) Blood 104 (4), 1002-1009
Publications

Mirza, R. et al. 3β-Hydroxysterol-Delta24 reductase plays an important role in long bone growth by protecting chondrocytes from reactive oxygen species. J. Bone Miner. Metab. 30, 144-53 (2012). IHC, Rat, Pig, Rabbit, Guinea pig, Mouse, Human, Zebrafish, Horse, Bovine, Dog, Goat 21845517

Gene SymbolIHH
Gene Full NameIndian hedgehog
Alias SymbolsBDA1, HHG2
NCBI Gene Id3549
Protein NameIndian hedgehog protein
Description of TargetIHH is an intercellular signal essential for a variety of patterning events during development. It binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. It is implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones and induces the expression of parathyroid hormone-related protein (PTHRP).
Uniprot IDQ14623
Protein Accession #NP_002172
Nucleotide Accession #NM_002181
Protein Size (# AA)411
Molecular Weight45kDa
Protein InteractionsRHOD; HHIP; PTCH2; PTCH1;
  1. What is the species homology for "IHH Antibody - N-terminal region : Biotin (ARP45230_T100-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "IHH Antibody - N-terminal region : Biotin (ARP45230_T100-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "IHH Antibody - N-terminal region : Biotin (ARP45230_T100-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IHH Antibody - N-terminal region : Biotin (ARP45230_T100-Biotin)"?

    This target may also be called "BDA1, HHG2" in publications.

  5. What is the shipping cost for "IHH Antibody - N-terminal region : Biotin (ARP45230_T100-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IHH Antibody - N-terminal region : Biotin (ARP45230_T100-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IHH Antibody - N-terminal region : Biotin (ARP45230_T100-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "45kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IHH Antibody - N-terminal region : Biotin (ARP45230_T100-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "IHH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IHH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IHH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IHH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IHH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IHH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IHH Antibody - N-terminal region : Biotin (ARP45230_T100-Biotin)
Your Rating
We found other products you might like!