Search Antibody, Protein, and ELISA Kit Solutions

IHH Antibody - N-terminal region (ARP45230_T100)

100 ul
$249.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45230_T100-FITC Conjugated

ARP45230_T100-HRP Conjugated

ARP45230_T100-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
IHC, WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
IHH
Official Gene Full Name:
Indian hedgehog
NCBI Gene Id:
3549
Protein Name:
Indian hedgehog protein
Swissprot Id:
Q14623
Protein Accession #:
NP_002172
Nucleotide Accession #:
NM_002181
Alias Symbols:
BDA1, HHG2
Replacement Item:
This antibody may replace item sc-1196 from Santa Cruz Biotechnology.
Description of Target:
IHH is an intercellular signal essential for a variety of patterning events during development. It binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. It is implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones and induces the expression of parathyroid hormone-related protein (PTHRP).
Protein Size (# AA):
411
Molecular Weight:
45kDa
Purification:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IHH.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IHH.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human IHH
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data:
Anti-IHH (ARP45230_T100)
Peptide Sequence:
Synthetic peptide located within the following region: AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RHOD; HHIP; PTCH2; PTCH1;
Blocking Peptide:
For anti-IHH (ARP45230_T100) antibody is Catalog # AAP45230 (Previous Catalog # AAPP26226)
Datasheets/Manuals:
Printable datasheet for anti-IHH (ARP45230_T100) antibody
Target Reference:
Kobune,M., (2004) Blood 104 (4), 1002-1009
Publications:

Mirza, R. et al. 3b-Hydroxysterol-Delta24 reductase plays an important role in long bone growth by protecting chondrocytes from reactive oxygen species. J. Bone Miner. Metab. 30, 144-53 (2012). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21845517

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...