- Gene Symbol:
- IHH
- NCBI Gene Id:
- 3549
- Official Gene Full Name:
- Indian hedgehog
- Protein Name:
- Indian hedgehog protein
- Swissprot Id:
- Q14623
- Protein Accession #:
- NP_002172
- Nucleotide Accession #:
- NM_002181
- Alias Symbols:
- BDA1, HHG2
- Replacement Item:
- This antibody may replace item sc-1196 from Santa Cruz Biotechnology.
- Description of Target:
- IHH is an intercellular signal essential for a variety of patterning events during development. It binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. It is implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones and induces the expression of parathyroid hormone-related protein (PTHRP).
- Protein Size (# AA):
- 411
- Molecular Weight:
- 45kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Protein A purified
- Application:
- IHC, WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express IHH.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express IHH.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human IHH
- Tested Species Reactivity:
- Human, Mouse
- Predicted Homology Based on Immunogen Sequence:
- Cow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
- Complete computational species homology data:
- Anti-IHH (ARP45230_T100)
- Peptide Sequence:
- Synthetic peptide located within the following region: AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- RHOD; HHIP; PTCH2; PTCH1;
- Blocking Peptide:
- For anti-IHH (ARP45230_T100) antibody is Catalog # AAP45230 (Previous Catalog # AAPP26226)
- Datasheets/Manuals:
- Printable datasheet for anti-IHH (ARP45230_T100) antibody
- Target Reference:
- Kobune,M., (2004) Blood 104 (4), 1002-1009
- Publications:
Mirza, R. et al. 3β-Hydroxysterol-Delta24 reductase plays an important role in long bone growth by protecting chondrocytes from reactive oxygen species. J. Bone Miner. Metab. 30, 144-53 (2012). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21845517
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
