Size:100 ul
$249.00
In stock
SKU
ARP45230_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45230_T100-FITC Conjugated

ARP45230_T100-HRP Conjugated

ARP45230_T100-Biotin Conjugated

IHH Antibody - N-terminal region (ARP45230_T100)

Catalog#: ARP45230_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-1196 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human IHH
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Goat: 86%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Complete computational species homology data Anti-IHH (ARP45230_T100)
Peptide Sequence Synthetic peptide located within the following region: AAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIAR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-IHH (ARP45230_T100) antibody is Catalog # AAP45230 (Previous Catalog # AAPP26226)
Datasheets/Manuals Printable datasheet for anti-IHH (ARP45230_T100) antibody
Target Reference Kobune,M., (2004) Blood 104 (4), 1002-1009
Publications

Mirza, R. et al. 3b-Hydroxysterol-Delta24 reductase plays an important role in long bone growth by protecting chondrocytes from reactive oxygen species. J. Bone Miner. Metab. 30, 144-53 (2012). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 21845517

Gene Symbol IHH
Official Gene Full Name Indian hedgehog
Alias Symbols BDA1, HHG2
NCBI Gene Id 3549
Protein Name Indian hedgehog protein
Description of Target IHH is an intercellular signal essential for a variety of patterning events during development. It binds to the patched (PTC) receptor, which functions in association with smoothened (SMO), to activate the transcription of target genes. It is implicated in endochondral ossification: may regulate the balance between growth and ossification of the developing bones and induces the expression of parathyroid hormone-related protein (PTHRP).
Swissprot Id Q14623
Protein Accession # NP_002172
Nucleotide Accession # NM_002181
Protein Size (# AA) 411
Molecular Weight 45kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express IHH.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express IHH.
Protein Interactions RHOD; HHIP; PTCH2; PTCH1;
Write Your Own Review
You're reviewing:IHH Antibody - N-terminal region (ARP45230_T100)
Your Rating