Ighmbp2 Antibody - N-terminal region : FITC (ARP38126_P050-FITC)

Catalog No: ARP38126_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: QLLELERDAEVEERRSWQEHSSLRELQSRGVCLLKLQVSSQRTGLYGQRL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-Ighmbp2 (ARP38126_P050-FITC) antibody is Catalog # AAP38126 (Previous Catalog # AAPP20303)

Target Info

• Gene Symbol: Ighmbp2
• Gene Full Name: Immunoglobulin mu binding protein 2
• Alias Symbols: A, s, AEP, Smb, nmd, sma, Catf, RIPE, Smbp, Smub, Catf1, Smbp2, Smbp-2, Smubp2, RIPE3b1
• NCBI Gene Id: 20589
• Protein Name: DNA-binding protein SMUBP-2
• Description of Target: Ighmbp2 is a 5' to 3' helicase that unwinds RNA and DNA duplices in an ATP-dependent reaction. Ighmbp2 acts as a transcription regulator. Ighmbp2 is required for the transcriptional activation of the flounder liver-type antifreeze protein gene. Ighmbp2 exhibits strong binding specificity to the enhancer element B of the flounder antifreeze protein gene intron. Ighmbp2 binds to the insulin II gene RIPE3B enhancer region. Ighmbp2 may be involved in translation.Ighmbp2 is a DNA-binding protein specific to 5'-phosphorylated single-stranded guanine-rich sequence related to the immunoglobulin mu chain switch region.Ighmbp2 preferentially binds to the 5'-GGGCT-3' motif. Ighmbp2 interacts with tRNA-Tyr.
• Uniprot ID: P40694
• Protein Accession #: NP_033238
• Nucleotide Accession #: NM_009212
• Protein Size (# AA): 993
• Molecular Weight: 109kDa
• Protein Interactions: Gtf3c1; Hnrnph1; Ruvbl1; Abt1; Zbtb14; Tyr; Ighmbp2; Ruvbl2; Hspa1b; Slit3; Robo1;