Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

IGFBP7 Antibody - C-terminal region (ARP48174_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP48174_P050-FITC Conjugated

ARP48174_P050-HRP Conjugated

ARP48174_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Insulin-like growth factor binding protein 7
NCBI Gene Id:
Protein Name:
Insulin-like growth factor-binding protein 7
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-13095, HPA002196
Description of Target:
IGFBP7 contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 IGFBP N-terminal domain and 1 Kazal-like domain. It binds IGF-I and IGF-II with a relatively low affinity. IGFBP7 stimulates prostacyclin (PGI2) production.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IGFBP7.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IGFBP7.
The immunogen is a synthetic peptide directed towards the C terminal region of human IGFBP7
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Sheep: 93%
Complete computational species homology data:
Anti-IGFBP7 (ARP48174_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-IGFBP7 (ARP48174_P050) antibody is Catalog # AAP48174 (Previous Catalog # AAPY02582)
Printable datasheet for anti-IGFBP7 (ARP48174_P050) antibody
Target Reference:
Wajapeyee,N., (2008) Cell 132 (3), 363-374

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...