Size:100 ul
$319.00
In stock
SKU
ARP45685_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45685_P050-FITC Conjugated

ARP45685_P050-HRP Conjugated

ARP45685_P050-Biotin Conjugated

IGFBP4 Antibody - middle region (ARP45685_P050)

Catalog#: ARP45685_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Placenta, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Placenta, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-125487 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human IGFBP4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology dataAnti-IGFBP4 (ARP45685_P050)
Peptide SequenceSynthetic peptide located within the following region: RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-IGFBP4 (ARP45685_P050) antibody is Catalog # AAP45685 (Previous Catalog # AAPP25834)
Datasheets/ManualsPrintable datasheet for anti-IGFBP4 (ARP45685_P050) antibody
Target ReferenceDurai,R., (2007) Colorectal Dis 9 (7), 625-631
Publications

Shi, Z., Chiang, C.-I., Mistretta, T.-A., Major, A. & Mori-Akiyama, Y. SOX9 directly regulates IGFBP-4 in the intestinal epithelium. Am. J. Physiol. Gastrointest. Liver Physiol. 305, G74-83 (2013). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23660500

Gene SymbolIGFBP4
Official Gene Full NameInsulin-like growth factor binding protein 4
Alias SymbolsBP-4, HT29-IGFBP, IBP4, IGFBP-4
NCBI Gene Id3487
Protein NameInsulin-like growth factor-binding protein 4
Description of TargetIGFBP4 is a member of the insulin-like growth factor binding protein (IGFBP) family. IGFBP4 is a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot IdP22692
Protein Accession #NP_001543
Nucleotide Accession #NM_001552
Protein Size (# AA)258
Molecular Weight28kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express IGFBP4.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express IGFBP4.
Protein InteractionsKDM1A; SUV39H1; Hk3; Hk2; TF; PAPPA; IGF2; IGF1; CTSD;
Write Your Own Review
You're reviewing:IGFBP4 Antibody - middle region (ARP45685_P050)
Your Rating
Aviva Tissue Tool
Aviva Validation Data
Free Microscope
Assay Development