Search Antibody, Protein, and ELISA Kit Solutions

IGFBP4 Antibody - middle region (ARP45685_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45685_P050-FITC Conjugated

ARP45685_P050-HRP Conjugated

ARP45685_P050-Biotin Conjugated

Tested Species Reactivity:
Human, Mouse
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Additional Information:
IHC Information: Placenta, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Placenta, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-125487 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the middle region of human IGFBP4
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data:
Anti-IGFBP4 (ARP45685_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-IGFBP4 (ARP45685_P050) antibody is Catalog # AAP45685 (Previous Catalog # AAPP25834)
Printable datasheet for anti-IGFBP4 (ARP45685_P050) antibody
Target Reference:
Durai,R., (2007) Colorectal Dis 9 (7), 625-631

Shi, Z., Chiang, C.-I., Mistretta, T.-A., Major, A. & Mori-Akiyama, Y. SOX9 directly regulates IGFBP-4 in the intestinal epithelium. Am. J. Physiol. Gastrointest. Liver Physiol. 305, G74-83 (2013). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23660500

Gene Symbol:
Official Gene Full Name:
Insulin-like growth factor binding protein 4
Alias Symbols:
NCBI Gene Id:
Protein Name:
Insulin-like growth factor-binding protein 4
Description of Target:
IGFBP4 is a member of the insulin-like growth factor binding protein (IGFBP) family. IGFBP4 is a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IGFBP4.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IGFBP4.
Protein Interactions:
KDM1A; SUV39H1; Hk3; Hk2; TF; PAPPA; IGF2; IGF1; CTSD;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...