Size:100 ul
$319.00
In Stock
SKU
ARP45685_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP45685_P050-FITC Conjugated

ARP45685_P050-HRP Conjugated

ARP45685_P050-Biotin Conjugated

More Information
Tested Species Reactivity Human, Mouse
Predicted Species Reactivity Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Additional Information IHC Information: Placenta, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
IHC Information: Placenta, Human: Formalin-Fixed, Paraffin-Embedded (FFPE)
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-125487 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human IGFBP4
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
Complete computational species homology data Anti-IGFBP4 (ARP45685_P050)
Peptide Sequence Synthetic peptide located within the following region: RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-IGFBP4 (ARP45685_P050) antibody is Catalog # AAP45685 (Previous Catalog # AAPP25834)
Datasheets/Manuals Printable datasheet for anti-IGFBP4 (ARP45685_P050) antibody
Target Reference Durai,R., (2007) Colorectal Dis 9 (7), 625-631
Publications

Shi, Z., Chiang, C.-I., Mistretta, T.-A., Major, A. & Mori-Akiyama, Y. SOX9 directly regulates IGFBP-4 in the intestinal epithelium. Am. J. Physiol. Gastrointest. Liver Physiol. 305, G74-83 (2013). IHC, WB, Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep 23660500

Gene Symbol IGFBP4
Official Gene Full Name Insulin-like growth factor binding protein 4
Alias Symbols BP-4, HT29-IGFBP, IBP4, IGFBP-4
NCBI Gene Id 3487
Protein Name Insulin-like growth factor-binding protein 4
Description of Target IGFBP4 is a member of the insulin-like growth factor binding protein (IGFBP) family. IGFBP4 is a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors.This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P22692
Protein Accession # NP_001543
Nucleotide Accession # NM_001552
Protein Size (# AA) 258
Molecular Weight 28kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express IGFBP4.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express IGFBP4.
Protein Interactions KDM1A; SUV39H1; Hk3; Hk2; TF; PAPPA; IGF2; IGF1; CTSD;
  1. What is the species homology for "IGFBP4 Antibody - middle region (ARP45685_P050)"?

    The tested species reactivity for this item is "Human, Mouse". This antibody is predicted to have homology to "Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep".

  2. How long will it take to receive "IGFBP4 Antibody - middle region (ARP45685_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "IGFBP4 Antibody - middle region (ARP45685_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IGFBP4 Antibody - middle region (ARP45685_P050)"?

    This target may also be called "BP-4, HT29-IGFBP, IBP4, IGFBP-4" in publications.

  5. What is the shipping cost for "IGFBP4 Antibody - middle region (ARP45685_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IGFBP4 Antibody - middle region (ARP45685_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IGFBP4 Antibody - middle region (ARP45685_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "28kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IGFBP4 Antibody - middle region (ARP45685_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "IGFBP4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IGFBP4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IGFBP4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IGFBP4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IGFBP4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IGFBP4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IGFBP4 Antibody - middle region (ARP45685_P050)
Your Rating
We found other products you might like!