IGFBP1 Antibody - C-terminal region (OABB02087)

Catalog No: OABB02087

Size:100UG

Anti-IGFBP1 Picoband antibody, OABB02087, Western blotting
All lanes: Anti IGFBP1 (OABB02087) at 0.5ug/ml
Lane 1: Rat Kidney Tissue Lysate at 50ug
Lane 2: Mouse Kidney Tissue Lysate at 50ug
Predicted bind size: 28KD
Observed bind size: 28KD

Product Info

• Tested Species Reactivity: Mouse, Rat
• Predicted Species Reactivity: Hamster|Mouse|Rat
• Product Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Clonality: Polyclonal
• Clone: Polyclonal
• Isotype: Rabbit IgG
• Host: Rabbit
• Application: Enzyme-linked immunosorbent assay|Western blot
• Additional Information: Notes: Tested Species: In-house tested species with positive results.
  Other applications have not been tested.
  Optimal dilutions should be determined by end users.
  Background: IGFBP1, Insulin-like growth factor-binding protein 1, also known as placental protein 12 (PP12), is a protein that in humans is encoded by the IGFBP1 gene. The IGFBP1 gene has 4 exons and spans 5.9 kb. And the IGFBP1gene is localized to 7p13-p12 by in situ hybridization. This gene is a member of the Insulin-like growth factor-binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a type-I thyroglobulin domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Reconstitution and Storage: 2°C to 8°C|-20°C
• Immunogen: Polypeptide
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: REIADLKKWKEPCQRELYKVLERLAAAQQKA
• Concentration: 500 ug/ml
• Specificity: No cross reactivity with other proteins.
• Application Info: Western blot: 0.1-0.5 ug/ml: Mouse, Rat
  ELISA : 0.1-0.5 ug/ml: Mouse
• Reference: 1. Alitalo, T., Kontula, K., Koistinen, R., Aalto-Setala, K., Julkunen, M., Janne, O. A., Seppala, M., de la Chapelle, A.The gene encoding human low-molecular weight insulin-like growth-factor binding protein (IGF-BP25): regional localization to 7p12-p13 and description of a DNA polymorphism.Hum. Genet. 83: 335-338, 1989.
  2. Brinkman, A., Groffen, C. A. H., Kortleve, D. J., Drop, S. L. S.Organization of the gene encoding the insulin-like growth factor binding protein IBP-1.Biochem. Biophys. Res. Commun. 157: 898-907, 1988.
  3. Leu, J. I.-J., George, D. L.Hepatic IGFBP1 is a prosurvival factor that binds to BAK, protects the liver from apoptosis, and antagonizes the proapoptotic actions of p53 at mitochondria.Genes Dev. 21: 3095-3109, 2007.
  
• Storage Buffer: Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Description: Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 1(IGFBP1) detection. Tested with WB, ELISA in Mouse;Rat.

Target Info

• Gene Symbol: Igfbp1
• Gene Full Name: insulin-like growth factor binding protein 1
• Alias Symbols: IBP-1;IGF-binding protein 1;IGFBP;INSULIN-LIKE GROWTH FACTOR BINDING PROTEIN 1 PRECURSOR (IGFBP-1) (IBP-1) (IGF-BINDING PROTEIN 1);insulin-like growth factor-binding protein 1.
• NCBI Gene Id: 16006
• Protein Name: Insulin-like growth factor-binding protein 1
• Description of Target: IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration (By similarity).
• Uniprot ID: P47876
• Molecular Weight: 29570 MW