Catalog No: AVARP00004_P050-FITC
Price: $434.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

IGF1R Antibody - middle region : FITC (AVARP00004_P050-FITC)

Datasheets/ManualsPrintable datasheet for anti-IGF1R (AVARP00004_P050-FITC) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC: Fluorescein Isothiocyanate
ApplicationIHC, IF, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human IGF1R
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
Concentration0.5 mg/ml
Blocking PeptideFor anti-IGF1R (AVARP00004_P050-FITC) antibody is Catalog # AAP30448 (Previous Catalog # AAPP01032)
SpecificityDirected to the beta chain of IGF1R
ReferenceUrano,T., (2008) Spine 33 (11), 1256-1261

Kubota, T. et al. Insulin-like growth factor-1 receptor in mature osteoblasts is required for periosteal bone formation induced by reloading. Acta Astronaut. 92, 73-78 (2013). IHC, Bovine, Dog, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish 23976802

Gene SymbolIGF1R
Gene Full NameInsulin-like growth factor 1 receptor
Alias SymbolsIGFR, CD221, IGFIR, JTK13
NCBI Gene Id3480
Protein NameInsulin-like growth factor 1 receptor
Description of TargetThis receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival.This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-140 DR007209.1 566-705 141-3559 X04434.1 136-3554 3560-4540 BC113610.1 3542-4522 4541-4921 DA486252.1 187-567 4922-5392 BX093045.1 248-718 5393-5768 CN414655.1 317-692 5769-6158 BM264223.1 185-574 6159-6580 BQ185364.1 187-608 6581-11242 AC069029.9 21278-25939 c
Uniprot IDP08069
Protein Accession #NP_000866
Nucleotide Accession #NM_000875
Protein Size (# AA)1367
Molecular Weight71kDa
Protein InteractionsKCNIP3; UBC; ESR1; PHB2; SHC1; FBXO6; SH2B1; Slc23a3; RPL11; HSP90AA1; GRB14; FFAR2; ARRB2; AMY2A; APP; RUVBL1; GNB2L1; ARRB1; YWHAG; TP53; NEDD4; MDM2; GRB10; SUMO1; CAMP; ERBB2; EGFR; KRT27; DOK5; DOK4; WISP2; EHD1; ARHGEF12; PIK3R3; VAV3; PRKD1; SOCS2;
  1. What is the species homology for "IGF1R Antibody - middle region : FITC (AVARP00004_P050-FITC)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Sheep, Zebrafish".

  2. How long will it take to receive "IGF1R Antibody - middle region : FITC (AVARP00004_P050-FITC)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "IGF1R Antibody - middle region : FITC (AVARP00004_P050-FITC)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IGF1R Antibody - middle region : FITC (AVARP00004_P050-FITC)"?

    This target may also be called "IGFR, CD221, IGFIR, JTK13" in publications.

  5. What is the shipping cost for "IGF1R Antibody - middle region : FITC (AVARP00004_P050-FITC)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IGF1R Antibody - middle region : FITC (AVARP00004_P050-FITC)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IGF1R Antibody - middle region : FITC (AVARP00004_P050-FITC)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "71kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IGF1R Antibody - middle region : FITC (AVARP00004_P050-FITC)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "IGF1R"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IGF1R"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IGF1R"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IGF1R"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IGF1R"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IGF1R"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IGF1R Antibody - middle region : FITC (AVARP00004_P050-FITC)
Your Rating
We found other products you might like!