Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
AVARP00004_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP00004_P050-FITC Conjugated

AVARP00004_P050-HRP Conjugated

AVARP00004_P050-Biotin Conjugated

IGF1R Antibody - middle region (AVARP00004_P050)

Rating:
80% of 100
Catalog#: AVARP00004_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman, Mouse
Predicted Species ReactivityCow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, IF, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-113594 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human IGF1R
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Pig: 100%; Rat: 92%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-IGF1R (AVARP00004_P050)
Peptide SequenceSynthetic peptide located within the following region: DRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-IGF1R (AVARP00004_P050) antibody is Catalog # AAP30448 (Previous Catalog # AAPP01032)
Datasheets/ManualsPrintable datasheet for anti-IGF1R (AVARP00004_P050) antibody
SpecificityDirected to the beta chain of IGF1R
Target ReferenceUrano,T., (2008) Spine 33 (11), 1256-1261
Publications

Kubota, T. et al. Insulin-like growth factor-1 receptor in mature osteoblasts is required for periosteal bone formation induced by reloading. Acta Astronaut. 92, 73-78 (2013). IHC, IF, WB, Cow, Dog, Horse, Human, Mouse, Pig, Rat, Sheep, Zebrafish 23976802

Gene SymbolIGF1R
Official Gene Full NameInsulin-like growth factor 1 receptor
Alias SymbolsCD221, IGFIR, JTK13, MGC142170, MGC142172, MGC18216, IGFR
NCBI Gene Id3480
Protein NameInsulin-like growth factor 1 receptor
Description of TargetThis receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival.This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-140 DR007209.1 566-705 141-3559 X04434.1 136-3554 3560-4540 BC113610.1 3542-4522 4541-4921 DA486252.1 187-567 4922-5392 BX093045.1 248-718 5393-5768 CN414655.1 317-692 5769-6158 BM264223.1 185-574 6159-6580 BQ185364.1 187-608 6581-11242 AC069029.9 21278-25939 c
Swissprot IdP08069
Protein Accession #NP_000866
Nucleotide Accession #NM_000875
Protein Size (# AA)1367
Molecular Weight71kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express IGF1R.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express IGF1R.
Protein InteractionsKCNIP3; UBC; ESR1; PHB2; SHC1; FBXO6; SH2B1; Slc23a3; RPL11; HSP90AA1; GRB14; FFAR2; ARRB2; AMY2A; APP; RUVBL1; GNB2L1; ARRB1; YWHAG; TP53; NEDD4; MDM2; GRB10; SUMO1; CAMP; ERBB2; EGFR; KRT27; DOK5; DOK4; WISP2; EHD1; ARHGEF12; PIK3R3; VAV3; PRKD1; SOCS2;
Write Your Own Review
You're reviewing:IGF1R Antibody - middle region (AVARP00004_P050)
Your Rating
Free Microscope
Aviva Travel Grant
Aviva Pathways
Aviva HIS tag Deal