Catalog No: OPCA70415
Price: $0.00
SKU
OPCA70415
Availability: Please Inquire. Lead time depends on expression system.
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ Ig heavy chain V-III region A4 Recombinant Protein (Mouse) (OPCA70415)
Datasheets/Manuals | Printable datasheet for OPCA70415 |
---|
Predicted Species Reactivity | Mouse |
---|---|
Product Format | Lyophilized powder |
Application | WB, ELISA |
Additional Information | For Research Use Only. Sterile filtering available upon request. Low endotoxin available upon request. |
Reconstitution and Storage | Briefly centrifuge lyophilized product prior to opening to bring the contents to the bottom. Please reconstitute protein to 0.1-1.0 mg/mL by adding deionized sterile water first, followed by addition of glycerol to a final concentration of 5-50%. Reconstituted product should be aliquoted for long-term storage at -20C/-80C. Our in house default final concentration of glycerol is 50% for reference. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | EVKLEESGGGLVQPGGSMKLSCVASGFTFSNYWMNWVRQSPEKGLEWVAEIRLKSHNYATHYAESVKGRFTISRDDSKSSVYLQMNNLRAEDTGIYYCTTGFAYWGQGTLVTV |
Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Tag | This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements. |
Protein Name | Ig heavy chain V-III region A4 |
---|---|
Uniprot ID | P01796 |
Protein Size (# AA) | 113 |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
Write Your Own Review