IFT172 Antibody - N-terminal region (ARP51661_P050)

Catalog No: ARP51661_P050

WB Suggested Anti-IFT172 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Lung

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IFT172
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: VKILGKERYLVAHTSETLLLGDLNTNRLSEIAWQGSGGNEKYFFENENVC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IFT172 (ARP51661_P050) antibody is Catalog # AAP51661 (Previous Catalog # AAPY03485)

Target Info

• Reference: Howard,P.W. (2000) J. Biol. Chem. 275 (18), 13336-13342
• Gene Symbol: IFT172
• Gene Full Name: Intraflagellar transport 172 homolog (Chlamydomonas)
• Alias Symbols: SLB, wim, RP71, BBS20, osm-1, NPHP17, SRTD10
• NCBI Gene Id: 26160
• Protein Name: Intraflagellar transport protein 172 homolog
• Description of Target: IFT172 is required for the maintenance and formation of cilia. IT plays an indirect role in hedgehog (Hh) signaling, cilia being required for all activity of the hedgehog pathway.
• Uniprot ID: Q9UG01
• Protein Accession #: NP_056477
• Nucleotide Accession #: NM_015662
• Protein Size (# AA): 1749
• Molecular Weight: 197kDa
• Protein Interactions: UBC; LHX4; LHX3;