IFT122 Antibody - middle region (ARP53816_P050)

Catalog No: ARP53816_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: IFT122
Sample Tissue: Human HepG2 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IFT122
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: QDLRYLELISSIEERKKRGETNNDLFLADVFSYQGKFHEAAKLYKRSGHE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IFT122 (ARP53816_P050) antibody is Catalog # AAP53816

Target Info

• Gene Symbol: IFT122
• Gene Full Name: intraflagellar transport 122
• Alias Symbols: CED, SPG, CED1, FAP80, WDR10, WDR10p, WDR140
• NCBI Gene Id: 55764
• Protein Name: Intraflagellar transport protein 122 homolog
• Description of Target: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Mutations in this gene cause cranioectodermal dysplasia-1. A related pseudogene is located on chromosome 3. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Uniprot ID: Q9HBG6-3
• Protein Accession #: NP_443715
• Nucleotide Accession #: NM_052989.2
• Protein Size (# AA): 1182
• Molecular Weight: 130 kDa
• Protein Interactions: UBC; gag-pol;