Search Antibody, Protein, and ELISA Kit Solutions

IFNGR2 Antibody - middle region (ARP46611_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP46611_P050-FITC Conjugated

ARP46611_P050-HRP Conjugated

ARP46611_P050-Biotin Conjugated

Gene Symbol:
IFNGR2
Official Gene Full Name:
Interferon gamma receptor 2 (interferon gamma transducer 1)
NCBI Gene Id:
3460
Protein Name:
Interferon gamma receptor 2
Swissprot Id:
P38484
Protein Accession #:
NP_005525
Nucleotide Accession #:
NM_005534
Alias Symbols:
AF-1, IFGR2, IFNGT1
Replacement Item:
This antibody may replace item sc-12752 from Santa Cruz Biotechnology.
Description of Target:
IFNGR2 is the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.This gene (IFNGR2) encodes the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
337
Molecular Weight:
35kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IFNGR2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IFNGR2.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human IFNGR2
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-IFNGR2 (ARP46611_P050)
Peptide Sequence:
Synthetic peptide located within the following region: WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
RPL37A; CAMK2D; ELAVL1; DNAJA3; JAK2; IFNG; NR3C1; ANXA5; IFNGR1;
Blocking Peptide:
For anti-IFNGR2 (ARP46611_P050) antibody is Catalog # AAP46611 (Previous Catalog # AAPS19711)
Datasheets/Manuals:
Printable datasheet for anti-IFNGR2 (ARP46611_P050) antibody
Target Reference:
Jin,Y.H., (2008) Biochem. Biophys. Res. Commun. 368 (3), 690-695
Publications:

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Human 23103828

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...