Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP46611_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP46611_P050-FITC Conjugated

ARP46611_P050-HRP Conjugated

ARP46611_P050-Biotin Conjugated

IFNGR2 Antibody - middle region (ARP46611_P050)

Catalog#: ARP46611_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-12752 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human IFNGR2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-IFNGR2 (ARP46611_P050)
Peptide Sequence Synthetic peptide located within the following region: WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-IFNGR2 (ARP46611_P050) antibody is Catalog # AAP46611 (Previous Catalog # AAPS19711)
Datasheets/Manuals Printable datasheet for anti-IFNGR2 (ARP46611_P050) antibody
Target Reference Jin,Y.H., (2008) Biochem. Biophys. Res. Commun. 368 (3), 690-695
Publications

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Human 23103828

Gene Symbol IFNGR2
Official Gene Full Name Interferon gamma receptor 2 (interferon gamma transducer 1)
Alias Symbols AF-1, IFGR2, IFNGT1
NCBI Gene Id 3460
Protein Name Interferon gamma receptor 2
Description of Target IFNGR2 is the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.This gene (IFNGR2) encodes the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P38484
Protein Accession # NP_005525
Nucleotide Accession # NM_005534
Protein Size (# AA) 337
Molecular Weight 35kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express IFNGR2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express IFNGR2.
Protein Interactions RPL37A; CAMK2D; ELAVL1; DNAJA3; JAK2; IFNG; NR3C1; ANXA5; IFNGR1;
  1. What is the species homology for "IFNGR2 Antibody - middle region (ARP46611_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "IFNGR2 Antibody - middle region (ARP46611_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "IFNGR2 Antibody - middle region (ARP46611_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IFNGR2 Antibody - middle region (ARP46611_P050)"?

    This target may also be called "AF-1, IFGR2, IFNGT1" in publications.

  5. What is the shipping cost for "IFNGR2 Antibody - middle region (ARP46611_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IFNGR2 Antibody - middle region (ARP46611_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IFNGR2 Antibody - middle region (ARP46611_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IFNGR2 Antibody - middle region (ARP46611_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "IFNGR2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IFNGR2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IFNGR2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IFNGR2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IFNGR2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IFNGR2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IFNGR2 Antibody - middle region (ARP46611_P050)
Your Rating
We found other products you might like!