Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP46611_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP46611_P050-FITC Conjugated

ARP46611_P050-HRP Conjugated

ARP46611_P050-Biotin Conjugated

IFNGR2 Antibody - middle region (ARP46611_P050)

Catalog#: ARP46611_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-12752 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human IFNGR2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-IFNGR2 (ARP46611_P050)
Peptide Sequence Synthetic peptide located within the following region: WEKGGIQQVKGPFRSNSISLDNLKPSRVYCLQVQAQLLWNKSNIFRVGHL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-IFNGR2 (ARP46611_P050) antibody is Catalog # AAP46611 (Previous Catalog # AAPS19711)
Datasheets/Manuals Printable datasheet for anti-IFNGR2 (ARP46611_P050) antibody
Target Reference Jin,Y.H., (2008) Biochem. Biophys. Res. Commun. 368 (3), 690-695
Publications

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Human 23103828

Gene Symbol IFNGR2
Official Gene Full Name Interferon gamma receptor 2 (interferon gamma transducer 1)
Alias Symbols AF-1, IFGR2, IFNGT1
NCBI Gene Id 3460
Protein Name Interferon gamma receptor 2
Description of Target IFNGR2 is the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance.This gene (IFNGR2) encodes the non-ligand-binding beta chain of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. Defects in IFNGR2 are a cause of mendelian susceptibility to mycobacterial disease (MSMD), also known as familial disseminated atypical mycobacterial infection. MSMD is a genetically heterogeneous disease with autosomal recessive, autosomal dominant or X-linked inheritance. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id P38484
Protein Accession # NP_005525
Nucleotide Accession # NM_005534
Protein Size (# AA) 337
Molecular Weight 35kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express IFNGR2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express IFNGR2.
Protein Interactions RPL37A; CAMK2D; ELAVL1; DNAJA3; JAK2; IFNG; NR3C1; ANXA5; IFNGR1;
Write Your Own Review
You're reviewing:IFNGR2 Antibody - middle region (ARP46611_P050)
Your Rating