IFNA5 Antibody - middle region (ARP54652_P050)

Catalog No: ARP54652_P050

WB Suggested Anti-IFNA5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: MCF7 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IFNA5
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Guinea Pig: 85%; Horse: 77%; Human: 100%; Mouse: 77%; Rat: 77%
• Peptide Sequence: Synthetic peptide located within the following region: TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IFNA5 (ARP54652_P050) antibody is Catalog # AAP54652 (Previous Catalog # AAPP31443)
• Reference: Janssen,R., (2007) J. Infect. Dis. 196 (6), 826-834

Target Info

• Gene Symbol: IFNA5
• Gene Full Name: Interferon, alpha 5
• Alias Symbols: INA5, INFA5, leIF G, IFN-alphaG, IFN-alpha-5
• NCBI Gene Id: 3442
• Protein Name: Interferon alpha-5
• Description of Target: Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.
• Uniprot ID: P01569
• Protein Accession #: NP_002160
• Nucleotide Accession #: NM_002169
• Protein Size (# AA): 189
• Molecular Weight: 20kDa
• Protein Interactions: APP; IFNAR2;