SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP36486_P050
Price: $0.00
SKU
ARP36486_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-IFIH1 (ARP36486_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human IFIH1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Horse: 85%; Human: 100%; Mouse: 77%; Pig: 77%; Rat: 82%
Peptide SequenceSynthetic peptide located within the following region: QINDTIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDED
Concentration0.5 mg/ml
Blocking PeptideFor anti-IFIH1 (ARP36486_P050) antibody is Catalog # AAP36486 (Previous Catalog # AAPS07201)
Sample Type Confirmation

IFIH1 is supported by BioGPS gene expression data to be expressed in HEK293T

ReferenceQu,H.Q., (2008) Diabetologia 51 (3), 473-475
Gene SymbolIFIH1
Gene Full NameInterferon induced with helicase C domain 1
Alias SymbolsAGS7, Hlcd, MDA5, MDA-5, RLR-2, IDDM19, SGMRT1
NCBI Gene Id64135
Protein NameInterferon-induced helicase C domain-containing protein 1
Description of TargetDEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. IFIH1 is a DEAD box protein that is upregulated in response to treatment with beta-interferon (IFNB) and a protein kinase C-activating compound, mezerein (MEZ). Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon (IFNB) and a protein kinase C-activating compound, mezerein (MEZ). Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ9BYX4
Protein Accession #NP_071451
Nucleotide Accession #NM_022168
Protein Size (# AA)1025
Molecular Weight117kDa
Protein InteractionsUSP21; USP3; UBC; NLRC5; APP; TSPAN6; MAVS; PCBP2; PIAS2; SUMO1; IDE;
  1. What is the species homology for "IFIH1 Antibody - middle region (ARP36486_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Horse, Pig".

  2. How long will it take to receive "IFIH1 Antibody - middle region (ARP36486_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "IFIH1 Antibody - middle region (ARP36486_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IFIH1 Antibody - middle region (ARP36486_P050)"?

    This target may also be called "AGS7, Hlcd, MDA5, MDA-5, RLR-2, IDDM19, SGMRT1" in publications.

  5. What is the shipping cost for "IFIH1 Antibody - middle region (ARP36486_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IFIH1 Antibody - middle region (ARP36486_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IFIH1 Antibody - middle region (ARP36486_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "117kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IFIH1 Antibody - middle region (ARP36486_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "IFIH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IFIH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IFIH1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IFIH1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IFIH1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IFIH1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IFIH1 Antibody - middle region (ARP36486_P050)
Your Rating
We found other products you might like!