Search Antibody, Protein, and ELISA Kit Solutions

IFIH1 Antibody - middle region (ARP36487_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP36487_P050-FITC Conjugated

ARP36487_P050-HRP Conjugated

ARP36487_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
IFIH1
Official Gene Full Name:
interferon induced with helicase C domain 1
NCBI Gene Id:
64135
Protein Name:
Interferon-induced helicase C domain-containing protein 1
Swissprot Id:
Q9BYX4
Protein Accession #:
NP_071451
Nucleotide Accession #:
NM_022168.3
Alias Symbols:
AGS7, Hlcd, MDA5, MDA-5, RLR-2, IDDM19, SGMRT1
Description of Target:
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon and a protein kinase C-activating compound, mezerein. Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation. Genetic variation in this gene is associated with diabetes mellitus insulin-dependent type 19.
Protein Size (# AA):
1025
Molecular Weight:
112 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IFIH1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IFIH1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human IFIH1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%
Complete computational species homology data:
Anti-IFIH1 (ARP36487_P050)
Peptide Sequence:
Synthetic peptide located within the following region: PYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
USP21; USP3; UBC; NLRC5; APP; TSPAN6; MAVS; PCBP2; PIAS2; SUMO1; IDE;
Blocking Peptide:
For anti-IFIH1 (ARP36487_P050) antibody is Catalog # AAP36487
Datasheets/Manuals:
Printable datasheet for anti-IFIH1 (ARP36487_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...