Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP36487_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP36487_P050-FITC Conjugated

ARP36487_P050-HRP Conjugated

ARP36487_P050-Biotin Conjugated

IFIH1 Antibody - middle region (ARP36487_P050)

Catalog#: ARP36487_P050
Domestic: within 24 hours delivery | International: 3-5 business days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human IFIH1
Purification Affinity purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 92%; Rabbit: 93%; Rat: 92%
Complete computational species homology data Anti-IFIH1 (ARP36487_P050)
Peptide Sequence Synthetic peptide located within the following region: PYQMEVAQPALEGKNIIICLPTGSGKTRVAVYIAKDHLDKKKKASEPGKVIV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-IFIH1 (ARP36487_P050) antibody is Catalog # AAP36487
Datasheets/Manuals Printable datasheet for anti-IFIH1 (ARP36487_P050) antibody
Gene Symbol IFIH1
Official Gene Full Name interferon induced with helicase C domain 1
Alias Symbols AGS7, Hlcd, MDA5, MDA-5, RLR-2, IDDM19, SGMRT1
NCBI Gene Id 64135
Protein Name Interferon-induced helicase C domain-containing protein 1
Description of Target DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein that is upregulated in response to treatment with beta-interferon and a protein kinase C-activating compound, mezerein. Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation. Genetic variation in this gene is associated with diabetes mellitus insulin-dependent type 19.
Swissprot Id Q9BYX4
Protein Accession # NP_071451
Nucleotide Accession # NM_022168.3
Protein Size (# AA) 1025
Molecular Weight 112 kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express IFIH1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express IFIH1.
Protein Interactions USP21; USP3; UBC; NLRC5; APP; TSPAN6; MAVS; PCBP2; PIAS2; SUMO1; IDE;
  1. What is the species homology for "IFIH1 Antibody - middle region (ARP36487_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "IFIH1 Antibody - middle region (ARP36487_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 business days".

  3. What buffer format is "IFIH1 Antibody - middle region (ARP36487_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "IFIH1 Antibody - middle region (ARP36487_P050)"?

    This target may also be called "AGS7, Hlcd, MDA5, MDA-5, RLR-2, IDDM19, SGMRT1" in publications.

  5. What is the shipping cost for "IFIH1 Antibody - middle region (ARP36487_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "IFIH1 Antibody - middle region (ARP36487_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "IFIH1 Antibody - middle region (ARP36487_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "112 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "IFIH1 Antibody - middle region (ARP36487_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "IFIH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "IFIH1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "IFIH1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "IFIH1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "IFIH1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "IFIH1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:IFIH1 Antibody - middle region (ARP36487_P050)
Your Rating
We found other products you might like!