Aviva Systems Biology office will be closed for Memorial Day - May 27, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

IFI35 Antibody - N-terminal region : FITC (ARP74581_P050-FITC)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74581_P050 Unconjugated

ARP74581_P050-HRP Conjugated

ARP74581_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
IFI35
Official Gene Full Name:
interferon induced protein 35
NCBI Gene Id:
3430
Protein Name:
interferon-induced 35 kDa protein
Swissprot Id:
P80217
Protein Accession #:
XP_005257359
Alias Symbols:
IFP35
Protein Size (# AA):
286
Molecular Weight:
31kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IFI35.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IFI35.
Immunogen:
The immunogen is a synthetic peptide directed towards the N-terminal region of Human IN35
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: QEEQARLKMRLWDLQQLRKELGDSPKDKVPFSVPKIPLVFRGHTQQDPEV
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
KDM1A; UBC; CLEC4G; PLEKHO1; MAPK1; BATF; NMI;
Blocking Peptide:
For anti-IFI35 (ARP74581_P050-FITC) antibody is Catalog # AAP74581
Datasheets/Manuals:
Printable datasheet for anti-IFI35 (ARP74581_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...