IER5L Antibody - middle region (ARP55970_P050)

Catalog No: ARP55970_P050

WB Suggested Anti-IER5L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: NCI-H226 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IER5L
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SNLISIFGSGFSGLVSRQPDSSEQPPPLNGQLCAKQALASLGAWTRAIVA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IER5L (ARP55970_P050) antibody is Catalog # AAP55970 (Previous Catalog # AAPP37318)
• Reference: Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954

Target Info

• Gene Symbol: IER5L
• Gene Full Name: Immediate early response 5-like
• Alias Symbols: bA247A12.2
• NCBI Gene Id: 389792
• Protein Name: Immediate early response gene 5-like protein
• Description of Target: The specific function of this protein remains unknown.
• Uniprot ID: Q5T953
• Protein Accession #: NP_982258
• Nucleotide Accession #: NM_203434
• Protein Size (# AA): 404
• Molecular Weight: 42kDa
• Protein Interactions: UBC;