Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP56939_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP56939_P050-FITC Conjugated

ARP56939_P050-HRP Conjugated

ARP56939_P050-Biotin Conjugated

IER5 Antibody - N-terminal region (ARP56939_P050)

Catalog#: ARP56939_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-162955 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human IER5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 77%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology dataAnti-IER5 (ARP56939_P050)
Peptide SequenceSynthetic peptide located within the following region: MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-IER5 (ARP56939_P050) antibody is Catalog # AAP56939 (Previous Catalog # AAPP39129)
Datasheets/ManualsPrintable datasheet for anti-IER5 (ARP56939_P050) antibody
Target ReferenceGregory,S.G., (2006) Nature 441 (7091), 315-321
Publications

Robinson, P. M. et al. Proteolytic processing of connective tissue growth factor in normal ocular tissues and during corneal wound healing. Invest. Ophthalmol. Vis. Sci. 53, 8093-103 (2012). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish 23139278

Gene SymbolIER5
Official Gene Full NameImmediate early response 5
Alias SymbolsMGC102760, SBBI48
NCBI Gene Id51278
Protein NameImmediate early response gene 5 protein
Description of TargetThis gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals. Studies in rats found the expression of a similar gene
Swissprot IdQ5VY09
Protein Accession #NP_057629
Nucleotide Accession #NM_016545
Protein Size (# AA)327
Molecular Weight34kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express IER5.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express IER5.
Protein InteractionsAICDA; UBD; PPP2R2B;
Write Your Own Review
You're reviewing:IER5 Antibody - N-terminal region (ARP56939_P050)
Your Rating
Assay Development
Aviva Travel Grant
Aviva Live Chat
Free Microscope