Search Antibody, Protein, and ELISA Kit Solutions

IER5 antibody - N-terminal region (ARP56939_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56939_P050-FITC Conjugated

ARP56939_P050-HRP Conjugated

ARP56939_P050-Biotin Conjugated

Gene Symbol:
IER5
NCBI Gene Id:
51278
Official Gene Full Name:
Immediate early response 5
Protein Name:
Immediate early response gene 5 protein
Swissprot Id:
Q5VY09
Protein Accession #:
NP_057629
Nucleotide Accession #:
NM_016545
Alias Symbols:
MGC102760, SBBI48
Replacement Item:
This antibody may replace item sc-162955 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals. Studies in rats found the expression of a similar gene
Protein Size (# AA):
327
Molecular Weight:
34kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express IER5.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express IER5.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human IER5
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 77%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-IER5 (ARP56939_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
AICDA; UBD; PPP2R2B;
Blocking Peptide:
For anti-IER5 (ARP56939_P050) antibody is Catalog # AAP56939 (Previous Catalog # AAPP39129)
Datasheets/Manuals:
Printable datasheet for anti-IER5 (ARP56939_P050) antibody
Target Reference:
Gregory,S.G., (2006) Nature 441 (7091), 315-321
Publications:

Robinson, P. M. et al. Proteolytic processing of connective tissue growth factor in normal ocular tissues and during corneal wound healing. Invest. Ophthalmol. Vis. Sci. 53, 8093-103 (2012). WB, Cow, Dog, Guinea Pig, Human, Mouse, Rat, Zebrafish 23139278

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...