IDH3G Antibody - middle region (ARP82981_P050)

Catalog No: ARP82981_P050

Host: Rabbit
Target Name: IDH3G
Sample Tissue: Human 293T Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human IDH3G
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: LYGKWTECLYSVDPATFDAYKKNDKKNTEEKKNSKQMSTSEELDEMPVPD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IDH3G (ARP82981_P050) antibody is Catalog # AAP82981

Target Info

• Gene Symbol: IDH3G
• Gene Full Name: IDH3G
• Alias Symbols: H-IDHG
• NCBI Gene Id: 3421
• Protein Name: isocitrate dehydrogenase [NAD] subunit gamma, mitochondrial
• Description of Target: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the gamma subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase. This gene is a candidate gene for periventricular heterotopia. Several alternatively spliced transcript variants of this gene have been described, but only some of their full length natures have been determined.
• Uniprot ID: P51553-2
• Protein Accession #: NP_004126.1
• Nucleotide Accession #: NM_004135.3
• Protein Size (# AA): 41
• Molecular Weight: 380