Size:100 ul
$249.00
In Stock
SKU
ARP42237_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP42237_T100-FITC Conjugated

ARP42237_T100-HRP Conjugated

ARP42237_T100-Biotin Conjugated

IDH3A Antibody - N-terminal region (ARP42237_T100)

Catalog#: ARP42237_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB, IP
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-366994 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human IDH3A
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Complete computational species homology dataAnti-IDH3A (ARP42237_T100)
Peptide SequenceSynthetic peptide located within the following region: MKIFDAAKAPIQWEERNVTAIQGPGGKWMIPSEAKESMDKNKMGLKGPLK
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-IDH3A (ARP42237_T100) antibody is Catalog # AAP42237 (Previous Catalog # AAPP24660)
Datasheets/ManualsPrintable datasheet for anti-IDH3A (ARP42237_T100) antibody
Sample Type Confirmation

IDH3A is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Subunitalpha, mitochondrial
Target ReferenceSoundar,S., (2003) J. Biol. Chem. 278 (52), 52146-52153
Publications

Lin, C.-C. et al. Loss of the respiratory enzyme citrate synthase directly links the Warburg effect to tumor malignancy. Sci. Rep. 2, 785 (2012). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 23139858

Gene SymbolIDH3A
Official Gene Full NameIsocitrate dehydrogenase 3 (NAD+) alpha
NCBI Gene Id3419
Protein NameIsocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
Description of TargetIsocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. IDH3A is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase.Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. NAD(+)-dependent isocitrate dehydrogenases catalyze the allosterically regulated rate-limiting step of the tricarboxylic acid cycle. Each isozyme is a heterotetramer that is composed of two alpha subunits, one beta subunit, and one gamma subunit. The protein encoded by this gene is the alpha subunit of one isozyme of NAD(+)-dependent isocitrate dehydrogenase.
Swissprot IdP50213
Protein Accession #NP_005521
Nucleotide Accession #NM_005530
Protein Size (# AA)366
Molecular Weight40kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express IDH3A.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express IDH3A.
Protein InteractionsHUWE1; SUMO2; STAU1; UBC; MDM2; ADRB2; gag-pol; RAB4A; MBNL1; S100A16; SUCLA2; UQCRFS1P1; SUMO4; EBNA-LP; MYC; TERF2; TERF1; PSMD4; DDA1; DMWD; IDH3B; IDH3G;
Write Your Own Review
You're reviewing:IDH3A Antibody - N-terminal region (ARP42237_T100)
Your Rating
Aviva Live Chat
Aviva Validation Data
Aviva Travel Grant
Aviva Tissue Tool