Protein on Demand™ ID4 Recombinant Protein (Mouse) (OPCA23012)

Datasheets/Manuals	Printable datasheet for OPCA23012

Product Info
Predicted Species Reactivity	Mouse
Product Format	Liquid
Application	WB, ELISA
Reconstitution and Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPLHPAGACPVAPPRTPLTALNTDPAGAVNKQGDSILCR
Storage Buffer	Tris-based buffer,50% glycerol
Protein Range	1-161

Gene Full Name	inhibitor of DNA binding 4
Alias Symbols	Idb4, bHLHb27
NCBI Gene Id	15904
Protein Name	DNA-binding protein inhibitor ID-4
Uniprot ID	P41139
Protein Size (# AA)	161