Search Antibody, Protein, and ELISA Kit Solutions

ICA1 Antibody - N-terminal region (ARP54742_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP54742_P050-FITC Conjugated

ARP54742_P050-HRP Conjugated

ARP54742_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Islet cell autoantigen 1, 69kDa
NCBI Gene Id:
Protein Name:
Islet cell autoantigen 1
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
ICA69, ICAp69
Replacement Item:
This antibody may replace item sc-27536 from Santa Cruz Biotechnology.
Description of Target:
ICA1 is a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express ICA1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express ICA1.
The immunogen is a synthetic peptide directed towards the N terminal region of human ICA1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology data:
Anti-ICA1 (ARP54742_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SKAIVLYQKRICFLSQEENELGKFLRSQGFQDKTRAGKMMQATGKALCFS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-ICA1 (ARP54742_P050) antibody is Catalog # AAP54742 (Previous Catalog # AAPP31537)
Printable datasheet for anti-ICA1 (ARP54742_P050) antibody
Sample Type Confirmation:

There is BioGPS gene expression data showing that ICA1 is expressed in HepG2

Target Reference:
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...