IBA57 Antibody - middle region (ARP83638_P050)

Catalog No: ARP83638_P050

Host: Rabbit
Target Name: C1ORF69
Sample Tissue: Human THP-1 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1ORF69
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: VPGGRLGDLWDYHQHRYLQGVPEGVRDLPPGVALPLESNLAFMNGVSFTK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-IBA57 (ARP83638_P050) antibody is Catalog # AAP83638

Target Info

• Gene Symbol: IBA57
• Gene Full Name: IBA57, iron-sulfur cluster assembly
• Alias Symbols: MMDS3, SPG74, C1orf69
• NCBI Gene Id: 200205
• Protein Name: putative transferase CAF17, mitochondrial
• Description of Target: The protein encoded by this gene localizes to the mitochondrion and is part of the iron-sulfur cluster assembly pathway. The encoded protein functions late in the biosynthesis of mitochondrial 4Fe-4S proteins. Defects in this gene have been associated with autosomal recessive spastic paraplegia-74 and with multiple mitochondrial dysfunctions syndrome-3. Two transcript variants encoding different isoforms have been found for this gene. The smaller isoform is not likely to be localized to the mitochondrion since it lacks the amino-terminal transit peptide.
• Uniprot ID: Q5T440
• Protein Accession #: NP_001010867.1
• Nucleotide Accession #: NM_001010867.3
• Protein Size (# AA): 356
• Molecular Weight: 38 kDa