Catalog No: ARP52871_P050
Price: $0.00
SKU
ARP52871_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-HUS1B (ARP52871_P050) antibody
Product Info
ReferenceDufault,V.M., (2003) Genomics 82 (6), 644-651
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HUS1B
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF
Concentration0.5 mg/ml
Blocking PeptideFor anti-HUS1B (ARP52871_P050) antibody is Catalog # AAP52871 (Previous Catalog # AAPS30905)
Gene SymbolHUS1B
Gene Full NameHUS1 checkpoint homolog b (S. pombe)
Alias SymbolsMGC126746, MGC126748, RP11-532F6.1
NCBI Gene Id135458
Protein NameCheckpoint protein HUS1B
Description of TargetHUS1Bis most closely related to HUS1, a component of a cell cycle checkpoint protein complex involved in cell cycle arrest in response to DNA damage. HUS1B can interact with the check point protein RAD1 but not with RAD9. Overexpression of HUS1B has been shown to induce cell death, which suggests a related but distinct role of this protein, as compared to the HUS1.The protein encoded by this gene is most closely related to HUS1, a component of a cell cycle checkpoint protein complex involved in cell cycle arrest in response to DNA damage. This protein can interact with the check point protein RAD1 but not with RAD9. Overexpression of this protein has been shown to induce cell death, which suggests a related but distinct role of this protein, as compared to the HUS1.
Uniprot IDQ8NHY5
Protein Accession #NP_683762
Nucleotide Accession #NM_148959
Protein Size (# AA)278
Molecular Weight31kDa
Protein InteractionsRAD9B; RAD9A; HUS1; RAD1;
  1. What is the species homology for "HUS1B Antibody - N-terminal region (ARP52871_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "HUS1B Antibody - N-terminal region (ARP52871_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HUS1B Antibody - N-terminal region (ARP52871_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HUS1B Antibody - N-terminal region (ARP52871_P050)"?

    This target may also be called "MGC126746, MGC126748, RP11-532F6.1" in publications.

  5. What is the shipping cost for "HUS1B Antibody - N-terminal region (ARP52871_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HUS1B Antibody - N-terminal region (ARP52871_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HUS1B Antibody - N-terminal region (ARP52871_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "31kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HUS1B Antibody - N-terminal region (ARP52871_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HUS1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HUS1B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HUS1B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HUS1B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HUS1B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HUS1B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HUS1B Antibody - N-terminal region (ARP52871_P050)
Your Rating