SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: OASA11660 (Formerly GWB-Q00545)
Size:1MG
Price: $299.00
SKU
OASA11660
Availability: Domestic: within 1-2 weeks delivery | International: 1-2 weeks
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

Human IMMUNODEFICIENCY VIRUS 1 gp41 Antibody (OASA11660)

Datasheets/ManualsPrintable datasheet for Human IMMUNODEFICIENCY VIRUS 1 gp41 Antibody (OASA11660)
Product Info
Predicted Species ReactivityHuman Immunodeficiency Virus Type 1
Product FormatLiquid. Phosphate buffered saline
ClonalityPolyclonal
IsotypePolyclonal IgG
HostGoat
ApplicationELISA, ICC, IF
Reconstitution and Storage-20°C
ImmunogenSynthetic peptide RVVQREKRAVGIVGAMFLGFLGAAGSTMGAVSLTLTVQAR.
Concentration1 mg/ml
SpecificityGoat anti Human immunogeficiency virus gp41 antibody recognizes gp41 from human immunodeficiency virus 1. After cleavage of gp160 into gp120 and gp41, gp41 remains non-covalently bound to gp120 and aids the virus in entering the cell.
Purity> 98%
Application InfoELISA: 1/50-1/500
WB: 1/50-1/500
Protein NameEnvelope glycoprotein gp160
Uniprot IDQ70626
  1. What is the species homology for "Human IMMUNODEFICIENCY VIRUS 1 gp41 Antibody (OASA11660)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human Immunodeficiency Virus Type 1".

  2. How long will it take to receive "Human IMMUNODEFICIENCY VIRUS 1 gp41 Antibody (OASA11660)"?

    This item is available "Domestic: within 1-2 weeks delivery | International: 1-2 weeks".

  3. What buffer format is "Human IMMUNODEFICIENCY VIRUS 1 gp41 Antibody (OASA11660)" provided in?

    This item is provided in "Liquid. Phosphate buffered saline".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "Human IMMUNODEFICIENCY VIRUS 1 gp41 Antibody (OASA11660)"?

    This target may also be called "" in publications.

  5. What is the shipping cost for "Human IMMUNODEFICIENCY VIRUS 1 gp41 Antibody (OASA11660)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "Human IMMUNODEFICIENCY VIRUS 1 gp41 Antibody (OASA11660)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "Human IMMUNODEFICIENCY VIRUS 1 gp41 Antibody (OASA11660)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "Human IMMUNODEFICIENCY VIRUS 1 gp41 Antibody (OASA11660)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for ""?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for ""?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with ""?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with ""?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with ""?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with ""?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:Human IMMUNODEFICIENCY VIRUS 1 gp41 Antibody (OASA11660)
Your Rating