Human DEFENSIN BETA 2 Protein (OPSA11014)

Catalog No: OPSA11014 (Formerly GWB-A17DCA)

Size:20UG

Product Info

• Predicted Species Reactivity: Human
• Product Format: Lyophilized
• Application: Enzyme-linked immunosorbent assay|Functional assay|Western blot
• Additional Information: Endotoxin Level: 0.1 ng/ug
  Carrier Free: Yes
• Reconstitution and Storage: -20°C
• Purification: Purified recombinant BD-2, expressed in E. coli
• Concentration: 0.1 mg/ml
• Preparation: Purified recombinant BD-2, expressed in E. coli
• Purity: >98% by SDS PAGE and HPLC analysis.
• Biological Activity: Determined by its ability to chemoattract immature dendritic cells using a concentration of 10.0 - 100.0 ng/ml.
• Protein Sequence: GIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
• Application Info: ELISA: 0.2 - 0.4 ng/well. Recombinant human BD-2 may be used as a standard in ELISA applications with either a purified human BD-2 antibody or a biotinylated human BD-2 antibody.
  WB: 1.5 - 3.0 ng/lane. Recombinant human BD-2 may be used as a the positive control in Western Blotting applications with either a purified human BD-2 antibody or a biotinylated human BD-2 antibody.
  FN: 10 - 100 ng/mL.
• Reference: 1. Bals, R. et al. (1998) Human beta-Defensin 2 is a salt-sensitive peptide antibiotic expressed in human lung. J. Clin. Invest. 102: 874-880.
  2. Yang, D. et al. (1999) Beta-defensins: linking innate and adaptive immunity through dendritic and T cell CCR6. Science 286: 525-528.
  

Target Info

• Gene Symbol: DEFB4A
• Alias Symbols: BD-2, SAP1, DEFB2, DEFB4, HBD-2, DEFB-2, DEFB102
• NCBI Gene Id: 1673
• Protein Name: Beta-defensin 4A
• Description of Target: RECOMBINANT HUMAN DEFENSIN BETA 2
  Defensin beta-2 (BD-2), is a member of the beta defensin family, secreted at epithelial surfaces of the skin and respiratory tract and by some leukocytes. BD-2 is induced by bacterial products and cytokines during inflammation and functions as part of the innate immune system, having a wide ranging antimicrobial activity. BD-2 also functions as a chemoattractant to immature dendritic cells and memory T cells and acts as a ligand for TLR4, upregulating co-stimulatory molecules and inducing dendritic cell maturation.
• Uniprot ID: O15263
• Protein Accession #: NP_004933.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 4.3 kDa (41 amino acid sequence/residues)