HTR6 Antibody - middle region (ARP85051_P050)

Catalog No: ARP85051_P050

Host: Rabbit
Target Name: HTR6
Sample Tissue: Human COLO205 Whole Cell lysates
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HTR6
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: VANIVQAVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HTR6 (ARP85051_P050) antibody is Catalog # AAP85051

Target Info

• Gene Symbol: HTR6
• Gene Full Name: 5-hydroxytryptamine receptor 6
• Alias Symbols: 5-HT6, 5-HT6R
• NCBI Gene Id: 3362
• Protein Name: 5-hydroxytryptamine receptor 6
• Description of Target: This gene encodes a protein that belongs to the seven-transmembrane G protein-coupled receptor family of proteins. The encoded protein couples with the Gs alpha subunit and stimulates adenylate cyclase to activate the cyclic AMP-dependent signaling pathway. This receptor is thought to regulate cholinergic neuronal transmission in the brain. Several antidepressants and antipsychotic drugs have a high affinity for this receptor.
• Uniprot ID: P50406
• Protein Accession #: NP_000862.1
• Nucleotide Accession #: NM_000871.2
• Protein Size (# AA): 440
• Molecular Weight: 48 kDa