Search Antibody, Protein, and ELISA Kit Solutions

HTR3E antibody - middle region (ARP35532_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP35532_P050-FITC Conjugated

ARP35532_P050-HRP Conjugated

ARP35532_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
5-hydroxytryptamine (serotonin) receptor 3E, ionotropic
Protein Name:
5-hydroxytryptamine receptor 3E
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
5-HT3c1, MGC120035, MGC120036, MGC120037, 5-HT3E, 5-HT3-E
Replacement Item:
This antibody may replace item sc-515279 from Santa Cruz Biotechnology.
Description of Target:
HTR3E belongs to the ligand-gated ion channel receptor superfamily. HTR3E is a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes a subunit E of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. Genes encoding subunits C, D and E form a cluster on chromosome 3. An alternative splice variant has been described but its full length sequence has not been determined.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HTR3E.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HTR3E.
The immunogen is a synthetic peptide directed towards the middle region of human HTR3E
Tested Species Reactivity:
Human, Mouse
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Horse: 83%; Human: 100%; Rabbit: 83%
Complete computational species homology data:
Anti-HTR3E (ARP35532_P050)
Peptide Sequence:
Synthetic peptide located within the following region: RWLHSLLLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-HTR3E (ARP35532_P050) antibody is Catalog # AAP35532 (Previous Catalog # AAPP06772)
Printable datasheet for anti-HTR3E (ARP35532_P050) antibody
Target Reference:
Peters,J.A., Biochem. Soc. Trans. 32 (PT3), 547-552 (2004)

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...