HTR3A Antibody - N-terminal region : FITC (AVARP13046_P050-FITC)

Catalog No: AVARP13046_P050-FITC

Size:100ul

Product Info

• Publications:

  Rinaldi, A. et al. Serotonin receptor 3A expression in normal and neoplastic B cells. Pathobiology 77, 129-35 (2010). WB, Bovine, Dog, Horse, Human, Mouse, Rat 20516728

  More...

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR3A
• Predicted Homology Based on Immunogen Sequence: Cow: 78%; Dog: 78%; Horse: 91%; Human: 100%; Mouse: 78%; Rat: 78%
• Peptide Sequence: Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HTR3A (AVARP13046_P050-FITC) antibody is Catalog # AAP30718 (Previous Catalog # AAPP01375)

Target Info

• Reference: Panicker,S., et al., (2004) J. Biol. Chem. 279 (27), 28149-28158
• Gene Symbol: HTR3A
• Gene Full Name: 5-hydroxytryptamine (serotonin) receptor 3A, ionotropic
• Alias Symbols: HTR3, 5HT3R, 5-HT-3, 5-HT3A, 5-HT3R
• NCBI Gene Id: 3359
• Protein Name: 5-hydroxytryptamine receptor 3A
• Description of Target: HTR3A belongs to the ligand-gated ion channel receptor superfamily. It is the subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Uniprot ID: P46098
• Protein Accession #: NP_000860
• Nucleotide Accession #: NM_000869
• Protein Size (# AA): 478
• Molecular Weight: 55kDa
• Protein Interactions: HSPA5; CANX;