Catalog No: AVARP13046_P050-Biotin
Size:100ul
Price: $434.00
SKU
AVARP13046_P050-Biotin
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

HTR3A Antibody - N-terminal region : Biotin (AVARP13046_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-HTR3A (AVARP13046_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human HTR3A
Predicted Homology Based on Immunogen SequenceCow: 78%; Dog: 78%; Horse: 91%; Human: 100%; Mouse: 78%; Rat: 78%
Peptide SequenceSynthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV
Concentration0.5 mg/ml
Blocking PeptideFor anti-HTR3A (AVARP13046_P050-Biotin) antibody is Catalog # AAP30718 (Previous Catalog # AAPP01375)
ReferencePanicker,S., et al., (2004) J. Biol. Chem. 279 (27), 28149-28158
Publications

Rinaldi, A. et al. Serotonin receptor 3A expression in normal and neoplastic B cells. Pathobiology 77, 129-35 (2010). WB, Bovine, Dog, Horse, Human, Mouse, Rat 20516728

Gene SymbolHTR3A
Gene Full Name5-hydroxytryptamine (serotonin) receptor 3A, ionotropic
Alias SymbolsHTR3, 5HT3R, 5-HT-3, 5-HT3A, 5-HT3R
NCBI Gene Id3359
Protein Name5-hydroxytryptamine receptor 3A
Description of TargetHTR3A belongs to the ligand-gated ion channel receptor superfamily. It is the subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. Alternatively spliced transcript variants encoding different isoforms have been identified.
Uniprot IDP46098
Protein Accession #NP_000860
Nucleotide Accession #NM_000869
Protein Size (# AA)478
Molecular Weight55kDa
Protein InteractionsHSPA5; CANX;
  1. What is the species homology for "HTR3A Antibody - N-terminal region : Biotin (AVARP13046_P050-Biotin)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse".

  2. How long will it take to receive "HTR3A Antibody - N-terminal region : Biotin (AVARP13046_P050-Biotin)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HTR3A Antibody - N-terminal region : Biotin (AVARP13046_P050-Biotin)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HTR3A Antibody - N-terminal region : Biotin (AVARP13046_P050-Biotin)"?

    This target may also be called "HTR3, 5HT3R, 5-HT-3, 5-HT3A, 5-HT3R" in publications.

  5. What is the shipping cost for "HTR3A Antibody - N-terminal region : Biotin (AVARP13046_P050-Biotin)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HTR3A Antibody - N-terminal region : Biotin (AVARP13046_P050-Biotin)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HTR3A Antibody - N-terminal region : Biotin (AVARP13046_P050-Biotin)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HTR3A Antibody - N-terminal region : Biotin (AVARP13046_P050-Biotin)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "HTR3A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HTR3A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HTR3A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HTR3A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HTR3A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HTR3A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HTR3A Antibody - N-terminal region : Biotin (AVARP13046_P050-Biotin)
Your Rating