Search Antibody, Protein, and ELISA Kit Solutions

HTR3A Antibody - N-terminal region (AVARP13046_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

AVARP13046_P050-FITC Conjugated

AVARP13046_P050-HRP Conjugated

AVARP13046_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
5-hydroxytryptamine (serotonin) receptor 3A, ionotropic
NCBI Gene Id:
Protein Name:
5-hydroxytryptamine receptor 3A
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
HTR3, 5HT3R, 5-HT-3, 5-HT3A, 5-HT3R
Replacement Item:
This antibody may replace item sc-30562 from Santa Cruz Biotechnology.
Description of Target:
HTR3A belongs to the ligand-gated ion channel receptor superfamily. It is the subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. Alternatively spliced transcript variants encoding different isoforms have been identified.
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express HTR3A.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express HTR3A.
The immunogen is a synthetic peptide directed towards the N terminal region of human HTR3A
Predicted Homology Based on Immunogen Sequence:
Cow: 78%; Dog: 78%; Horse: 91%; Human: 100%; Mouse: 78%; Rat: 78%
Complete computational species homology data:
Anti-HTR3A (AVARP13046_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-HTR3A (AVARP13046_P050) antibody is Catalog # AAP30718 (Previous Catalog # AAPP01375)
Printable datasheet for anti-HTR3A (AVARP13046_P050) antibody
Target Reference:
Panicker,S., et al., (2004) J. Biol. Chem. 279 (27), 28149-28158

Rinaldi, A. et al. Serotonin receptor 3A expression in normal and neoplastic B cells. Pathobiology 77, 129-35 (2010). IHC, WB, Cow, Dog, Horse, Human, Mouse, Rat 20516728

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...