- Gene Symbol:
- HTR3A
- NCBI Gene Id:
- 3359
- Official Gene Full Name:
- 5-hydroxytryptamine (serotonin) receptor 3A, ionotropic
- Protein Name:
- 5-hydroxytryptamine receptor 3A
- Swissprot Id:
- P46098
- Protein Accession #:
- NP_000860
- Nucleotide Accession #:
- NM_000869
- Alias Symbols:
- HTR3, 5HT3R, 5-HT-3, 5-HT3A, 5-HT3R
- Replacement Item:
- This antibody may replace item sc-30562 from Santa Cruz Biotechnology.
- Description of Target:
- HTR3A belongs to the ligand-gated ion channel receptor superfamily. It is the subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Protein Size (# AA):
- 478
- Molecular Weight:
- 55kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Application:
- IHC, WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express HTR3A.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express HTR3A.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human HTR3A
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Cow: 78%; Dog: 78%; Horse: 91%; Human: 100%; Mouse: 78%; Rat: 78%
- Complete computational species homology data:
- Anti-HTR3A (AVARP13046_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Protein Interactions:
- HSPA5; CANX;
- Blocking Peptide:
- For anti-HTR3A (AVARP13046_P050) antibody is Catalog # AAP30718 (Previous Catalog # AAPP01375)
- Datasheets/Manuals:
- Printable datasheet for anti-HTR3A (AVARP13046_P050) antibody
- Target Reference:
- Panicker,S., et al., (2004) J. Biol. Chem. 279 (27), 28149-28158
- Publications:
Rinaldi, A. et al. Serotonin receptor 3A expression in normal and neoplastic B cells. Pathobiology 77, 129-35 (2010). IHC, WB, Cow, Dog, Horse, Human, Mouse, Rat 20516728
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
