HTR3A Antibody - N-terminal region (AVARP13046_P050)

Catalog No: AVARP13046_P050

Host: Rabbit
Target Name: 5HT3A
Sample Type: RPMI-8226 lysates
Antibody Dilution: 1.0ug/ml

WB Suggested Anti-HTR3A Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Host: Rabbit
Target Name: 5HT3A
Sample Type: 721_B Whole Cell lysates
Antibody Dilution: 5ug/ml

Human kidney

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR3A
• Predicted Homology Based on Immunogen Sequence: Cow: 78%; Dog: 78%; Horse: 91%; Human: 100%; Mouse: 78%; Rat: 78%
• Peptide Sequence: Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-HTR3A (AVARP13046_P050) antibody is Catalog # AAP30718 (Previous Catalog # AAPP01375)
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Panicker,S., et al., (2004) J. Biol. Chem. 279 (27), 28149-28158
• Publications:

  Rinaldi, A. et al. Serotonin receptor 3A expression in normal and neoplastic B cells. Pathobiology 77, 129-35 (2010). 20516728

Target Info

• Gene Symbol: HTR3A
• Gene Full Name: 5-hydroxytryptamine (serotonin) receptor 3A, ionotropic
• Alias Symbols: HTR3, 5HT3R, 5-HT-3, 5-HT3A, 5-HT3R
• NCBI Gene Id: 3359
• Protein Name: 5-hydroxytryptamine receptor 3A
• Description of Target: HTR3A belongs to the ligand-gated ion channel receptor superfamily. It is the subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Uniprot ID: P46098
• Protein Accession #: NP_000860
• Nucleotide Accession #: NM_000869
• Protein Size (# AA): 478
• Molecular Weight: 55 kDa
• Protein Interactions: HSPA5; CANX;