Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
SKU
AVARP13046_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

AVARP13046_P050-FITC Conjugated

AVARP13046_P050-HRP Conjugated

AVARP13046_P050-Biotin Conjugated

HTR3A Antibody - N-terminal region (AVARP13046_P050)

Catalog#: AVARP13046_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Horse, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-30562 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human HTR3A
Predicted Homology Based on Immunogen Sequence Cow: 78%; Dog: 78%; Horse: 91%; Human: 100%; Mouse: 78%; Rat: 78%
Complete computational species homology data Anti-HTR3A (AVARP13046_P050)
Peptide Sequence Synthetic peptide located within the following region: LLLPTLLAQGEARRSRNTTRPALLRLSDYLLTNYRKGVRPVRDWRKPTTV
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-HTR3A (AVARP13046_P050) antibody is Catalog # AAP30718 (Previous Catalog # AAPP01375)
Datasheets/Manuals Printable datasheet for anti-HTR3A (AVARP13046_P050) antibody
Target Reference Panicker,S., et al., (2004) J. Biol. Chem. 279 (27), 28149-28158
Publications

Rinaldi, A. et al. Serotonin receptor 3A expression in normal and neoplastic B cells. Pathobiology 77, 129-35 (2010). IHC, WB, Cow, Dog, Horse, Human, Mouse, Rat 20516728

Gene Symbol HTR3A
Official Gene Full Name 5-hydroxytryptamine (serotonin) receptor 3A, ionotropic
Alias Symbols HTR3, 5HT3R, 5-HT-3, 5-HT3A, 5-HT3R
NCBI Gene Id 3359
Protein Name 5-hydroxytryptamine receptor 3A
Description of Target HTR3A belongs to the ligand-gated ion channel receptor superfamily. It is the subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. Alternatively spliced transcript variants encoding different isoforms have been identified.
Swissprot Id P46098
Protein Accession # NP_000860
Nucleotide Accession # NM_000869
Protein Size (# AA) 478
Molecular Weight 55kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express HTR3A.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express HTR3A.
Protein Interactions HSPA5; CANX;
  1. What is the species homology for "HTR3A Antibody - N-terminal region (AVARP13046_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Horse, Human, Mouse, Rat".

  2. How long will it take to receive "HTR3A Antibody - N-terminal region (AVARP13046_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "HTR3A Antibody - N-terminal region (AVARP13046_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "HTR3A Antibody - N-terminal region (AVARP13046_P050)"?

    This target may also be called "HTR3, 5HT3R, 5-HT-3, 5-HT3A, 5-HT3R" in publications.

  5. What is the shipping cost for "HTR3A Antibody - N-terminal region (AVARP13046_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "HTR3A Antibody - N-terminal region (AVARP13046_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "HTR3A Antibody - N-terminal region (AVARP13046_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "HTR3A Antibody - N-terminal region (AVARP13046_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "HTR3A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "HTR3A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "HTR3A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "HTR3A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "HTR3A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "HTR3A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:HTR3A Antibody - N-terminal region (AVARP13046_P050)
Your Rating
We found other products you might like!